DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mirr and Tgif2

DIOPT Version :9

Sequence 1:NP_001261778.1 Gene:mirr / 39441 FlyBaseID:FBgn0014343 Length:682 Species:Drosophila melanogaster
Sequence 2:NP_001128455.1 Gene:Tgif2 / 499929 RGDID:1560115 Length:237 Species:Rattus norvegicus


Alignment Length:260 Identity:63/260 - (24%)
Similarity:97/260 - (37%) Gaps:69/260 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   221 MDLNGARRK--NATRETTSTLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLK 283
            :.|.|.|::  |..:|:...|:.||..|:.|.||::.||:.|:..|.:::.|:..||.||||||.
  Rat    13 LSLTGKRKRRGNLPKESVKILRDWLYLHRYNAYPSEQEKLSLSGQTNLSVLQICNWFINARRRLL 77

  Fly   284 KENKMTWEPRNRVDDDDANIDDDDDKNTEDNDLL--DAKDSGVGSTDDKDRSGRLGDMMTDRPGE 346
            .                              |:|  |.||....:.  ..|.|:..|:..  |..
  Rat    78 P------------------------------DMLRKDGKDPNQFTI--SRRGGKASDVAL--PRG 108

  Fly   347 SNNSEWSESRPGSPN------GSPDLYDRPGSMPPGAHP---LFHPAAL---------------- 386
            |:.|..:.|.|...|      .|..|:...|..|..:.|   |..|.||                
  Rat   109 SSPSLLAVSVPAPTNMLSLSVCSMPLHSGQGEKPAASFPQVELESPKALVTPGSTLTLLTRAEAG 173

  Fly   387 ---HHHFRPPAGSPPDIAAYHHHQQQLLQQ--HQQAQQNSLQTAVGGTAKPRIWSLADMASKDSK 446
               ...|..|..:||:.........|||.:  .|:|.:..||.. ...|.|.:.:...:.|:::|
  Rat   174 SPTGGLFNTPPPTPPEQDKDDFSSFQLLVEVALQRAAEMELQKQ-QDPAPPLLHTPLPLVSENAK 237

  Fly   447  446
              Rat   238  237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mirrNP_001261778.1 Homeobox_KN 242..281 CDD:283551 16/38 (42%)
Tgif2NP_001128455.1 Homeobox_KN 36..75 CDD:399131 16/38 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.