DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mirr and meis3

DIOPT Version :9

Sequence 1:NP_001261778.1 Gene:mirr / 39441 FlyBaseID:FBgn0014343 Length:682 Species:Drosophila melanogaster
Sequence 2:NP_001006782.1 Gene:meis3 / 448474 XenbaseID:XB-GENE-485337 Length:453 Species:Xenopus tropicalis


Alignment Length:208 Identity:54/208 - (25%)
Similarity:88/208 - (42%) Gaps:60/208 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   222 DLNGARRKNATR-----ETTSTLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRR 281
            ||:..:::|..|     ..|:.::|||.:|..:|||::.:|..||..|.:|:.||:.||.|||||
 Frog   260 DLDRDKKRNKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRR 324

  Fly   282 LKKENKMTWEPRNRVDDDDANIDDDDDKNTEDNDLLDAKD-SGVG----STDDKDRSGRLGD--- 338
            :.:                              .::|..: :|.|    |.|.::..|.:.|   
 Frog   325 IVQ------------------------------PMIDQSNRTGQGGAPYSPDGQNMGGYVMDGQQ 359

  Fly   339 -MMTDRPG-ESNNSEWSESRPGSPNGSPDLYDRPGSMPPGAHPLFHPAALH-------HHFRP-- 392
             |....|| :....:::.:....|.|.|.....| ::||.:..|.|..:||       ||...  
 Frog   360 HMGIRPPGFQGIPGDYTAAPSTMPMGFPPAGYTP-AIPPHSAGLRHGPSLHSYLPGHPHHASMIL 423

  Fly   393 PAGSPPDIAAYHH 405
            |||:.|     ||
 Frog   424 PAGTSP-----HH 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mirrNP_001261778.1 Homeobox_KN 242..281 CDD:283551 18/38 (47%)
meis3NP_001006782.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 33..64
Meis_PKNOX_N 102..186 CDD:374576
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 192..272 3/11 (27%)
Homeobox_KN 285..324 CDD:368670 18/38 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.