DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mirr and tgif1

DIOPT Version :9

Sequence 1:NP_001261778.1 Gene:mirr / 39441 FlyBaseID:FBgn0014343 Length:682 Species:Drosophila melanogaster
Sequence 2:NP_955861.1 Gene:tgif1 / 321756 ZFINID:ZDB-GENE-030131-475 Length:273 Species:Danio rerio


Alignment Length:287 Identity:71/287 - (24%)
Similarity:105/287 - (36%) Gaps:72/287 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 VAGASPWPYPSMYHPYDAAFAGYPFNSYGMDLNGARRKNATRETTSTLKAWLNEHKKNPYPTKGE 256
            ::|:......|:..|.|.:..|      |:.....||.|..:|:...|:.||.:|:.|.||::.|
Zfish    10 MSGSETEDEDSLDVPLDLSSNG------GVSGKRKRRGNLPKESVQILRDWLYQHRYNAYPSEQE 68

  Fly   257 KIMLAIITKMTLTQVSTWFANARRRLKKENKMTWEPRNRVDDDDANIDDDDDKNTEDNDLLDAKD 321
            |.:|:..|.::..||..||.||||||..|       ..|.|..|.|......:.::..::|    
Zfish    69 KALLSKQTHLSTLQVCNWFINARRRLLPE-------MLRKDGKDPNQFTISRRGSKGGEML---- 122

  Fly   322 SGVGSTDDKDRSGRLGDMMTDRPGESNNSEWSESRPGSP---------NGSPDLYDRPGSMPPGA 377
                  .|..:|.:.|.:..   ||..||    ..||||         ||.|.....| ..||..
Zfish   123 ------SDNSQSPKHGLLAN---GEDRNS----YEPGSPHPTSNTPTSNGYPKKALSP-KTPPSP 173

  Fly   378 HPLF-HPAALHHHFRPPAGSPPDIAAYHHHQQQLLQQHQQAQQNSLQTAV-GGTAKPRIWSLADM 440
            .|:. .|:.:.|                    ..:....|....:.:..| |.|..|    |.|.
Zfish   174 GPVLPRPSVICH--------------------TTITTATQGINTTTRLGVEGATELP----LTDA 214

  Fly   441 AS------KDSKDSSSGAKDNHPELPP 461
            ||      :.:....||..:..|..||
Zfish   215 ASLFGCRGEGNVSPQSGLFNTPPPTPP 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mirrNP_001261778.1 Homeobox_KN 242..281 CDD:283551 17/38 (45%)
tgif1NP_955861.1 Homeobox_KN 54..93 CDD:283551 17/38 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.