DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mirr and Tgif1

DIOPT Version :9

Sequence 1:NP_001261778.1 Gene:mirr / 39441 FlyBaseID:FBgn0014343 Length:682 Species:Drosophila melanogaster
Sequence 2:NP_001015020.1 Gene:Tgif1 / 316742 RGDID:1310517 Length:287 Species:Rattus norvegicus


Alignment Length:337 Identity:79/337 - (23%)
Similarity:117/337 - (34%) Gaps:106/337 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 VAGASPWPYPSMYHPYDAAFAG----------YPFNSYGMDLNGARRK--NATRETTSTLKAWLN 244
            :|| |.||   ..|...||.:|          .|.:......:|.||:  |..:|:...|:.||.
  Rat    10 LAG-SGWP---SRHGVVAAASGSDSEDEDSMDSPLDLSSSAASGKRRRRGNLPKESVQILRDWLY 70

  Fly   245 EHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRR-----LKKENKMTWEPRNRVDDDDANID 304
            ||:.|.||::.||.:|:..|.::..||..||.|||||     |:|:.|         |.:...|.
  Rat    71 EHRYNAYPSEQEKALLSQQTHLSTLQVCNWFINARRRLLPDMLRKDGK---------DPNQFTIS 126

  Fly   305 DDDDKNTEDNDLLDAKDSGVGSTDDKDRSGRLGDMMTDRPGESNNSEWSESRPGSPNGSPDLYDR 369
            ....|.:|.:.:                                     |:..|..|..|.|.:.
  Rat   127 RRGAKISEASSI-------------------------------------EAAMGIKNFMPTLEES 154

  Fly   370 P-GSMPPGAHP-LFHPAALHHHFRPPAGSP----PDIAAYHHHQQQLLQQHQQAQQNSLQTAVGG 428
            | .|...|.:| |..|.:.    :||:..|    |.:..:                 :..||:  
  Rat   155 PFHSCVVGPNPTLGRPVSP----KPPSPGPILARPSVICH-----------------TTVTAL-- 196

  Fly   429 TAKPRIWSLADMAS-KDSKDSSSGAKDNHPELPPAHPGFYGHPGQQPSPGKILSPLAARIPNYSP 492
              |...:||....| ..|.|....|..|..:....:|......|..|:|       .:.:.|..|
  Rat   197 --KDGPFSLCQAVSVGHSTDVQQVAPSNFTDASLRYPEDTCKSGPSPNP-------QSGLFNTPP 252

  Fly   493 YVRPDLYRGFYG 504
            ...|||.:.|.|
  Rat   253 PTPPDLNQDFSG 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mirrNP_001261778.1 Homeobox_KN 242..281 CDD:283551 18/38 (47%)
Tgif1NP_001015020.1 Homeobox_KN 68..107 CDD:283551 18/38 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.