DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mirr and Mkx

DIOPT Version :9

Sequence 1:NP_001261778.1 Gene:mirr / 39441 FlyBaseID:FBgn0014343 Length:682 Species:Drosophila melanogaster
Sequence 2:XP_008770033.2 Gene:Mkx / 291228 RGDID:1305652 Length:356 Species:Rattus norvegicus


Alignment Length:375 Identity:90/375 - (24%)
Similarity:145/375 - (38%) Gaps:98/375 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 GIAADQP---PFYANPAGIDLKENLVAGASPWPYPSMYHPYDAAFAGYPFNSYGMDLNGARRKNA 231
            |...|.|   |....|.|..||:||          |:.|....|..|....         .::.|
  Rat    31 GGVLDNPHTGPEVGIPDGPPLKDNL----------SLRHRRTGARPGGKVR---------HKRQA 76

  Fly   232 TRETTSTLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLK---KENKMTWEPR 293
            .::....||.||.:|:.||||||.|||:||:.::|||.|||.||||||||||   ::..::|..|
  Rat    77 LQDMARPLKQWLYKHRDNPYPTKTEKILLALGSQMTLVQVSNWFANARRRLKNTVRQPDLSWALR 141

  Fly   294 NRVDDDDANIDDDDDKNTEDNDLLDAKDSGVGSTDDKDRSGRLGDMMTDRPGESNNSEWSESRPG 358
            .::          .:|..:.|    |:...|.|.||                  :.||..|:.|.
  Rat   142 IKL----------YNKYVQGN----AERLSVSSADD------------------SCSEDGENPPR 174

  Fly   359 SPNGSPDLYDRPGSMPPGAHPLF--HPAALHHHFRPPAGSPPDIAAYHHHQQQLLQQHQQAQQNS 421
            :.      .:..|...|..|.:.  ..:|:....||.:.:..|..:...::..||.::   ..:|
  Rat   175 TH------MNEEGYSTPAHHTVIKGESSAIKAGGRPESRAAEDYVSPPKYKSSLLNRY---LNDS 230

  Fly   422 LQTAVGGTAKPRIWSLADMASKDSKDSSSGAKDNHPELPPAHPGFYGHPGQQPSPGKILSPLAAR 486
            |:..:.       .|.|.|.....::.|.....|..|                  .:::||.::.
  Rat   231 LRHVMA-------TSTAMMGKTRRRNHSGSFSSNEFE------------------EELVSPSSSE 270

  Fly   487 IPNYSPY--VRPDL--YRGFYGPAAAHLGAPTQEFLEHQRTFGASLAAHN 532
            ......|  ..||:  .:|..|.:.|:...|:::. .|.:...|::|..|
  Rat   271 TEGTFVYRTDTPDIGSTKGDKGDSTANRRGPSKDD-THWKEINAAMALTN 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mirrNP_001261778.1 Homeobox_KN 242..281 CDD:283551 26/38 (68%)
MkxXP_008770033.2 Homeobox_KN 87..126 CDD:399131 26/38 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.