DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mirr and Tgif1

DIOPT Version :9

Sequence 1:NP_001261778.1 Gene:mirr / 39441 FlyBaseID:FBgn0014343 Length:682 Species:Drosophila melanogaster
Sequence 2:NP_001157547.1 Gene:Tgif1 / 21815 MGIID:1194497 Length:305 Species:Mus musculus


Alignment Length:347 Identity:78/347 - (22%)
Similarity:116/347 - (33%) Gaps:120/347 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 PAGIDLKENLVA--GASPWPYPSMYHPYDAAFAGYPFNSYGMDLNGARRK--NATRETTSTLKAW 242
            |..::| |.|||  |:......||..|.|.:.:.         .:|.||:  |..:|:...|:.|
Mouse    32 PRVVEL-EGLVAASGSDSEDEDSMDSPLDLSSSA---------ASGKRRRRGNLPKESVQILRDW 86

  Fly   243 LNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRR-----LKKENKMTWEPRNRVDDDDAN 302
            |.||:.|.||::.||.:|:..|.::..||..||.|||||     |:|:.|         |.:...
Mouse    87 LYEHRYNAYPSEQEKALLSQQTHLSTLQVCNWFINARRRLLPDMLRKDGK---------DPNQFT 142

  Fly   303 IDDDDDKNTEDNDLLDAKDSGVGSTDDKDRSGRLGDMMTDRPGESNNSEWSESRPGSPNGSPDLY 367
            |.....|.:|.:.:                                     |:..|..|..|.|.
Mouse   143 ISRRGAKISEASSI-------------------------------------EAAMGIKNFMPTLE 170

  Fly   368 DRP-GSMPPGAHPLFHPAALHHHFRPPAGSPPDIAAYHHHQQQLLQQHQQAQQNSLQTAVGGTAK 431
            :.| .|...|.:|...        ||.:..||...:.                         .|:
Mouse   171 ESPFHSCVVGPNPTLG--------RPVSPKPPSPGSI-------------------------LAR 202

  Fly   432 PR-IWSLADMASKDSKDS-----SSGAKDNHPELPPA--------HPGFYGHPGQQPSPGKILSP 482
            |. |......|.||...|     ..|...:.|::.|:        :|......|..|:|      
Mouse   203 PSVICHTTVTALKDGPFSLCQPIGVGQSTDVPQIAPSNFTDTSLVYPEDTCKSGPSPNP------ 261

  Fly   483 LAARIPNYSPYVRPDLYRGFYG 504
             .:.:.|..|...|||.:.|.|
Mouse   262 -QSGLFNTPPPTPPDLNQDFSG 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mirrNP_001261778.1 Homeobox_KN 242..281 CDD:283551 18/38 (47%)
Tgif1NP_001157547.1 Homeobox_KN 86..125 CDD:283551 18/38 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.