DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mirr and Mkx

DIOPT Version :9

Sequence 1:NP_001261778.1 Gene:mirr / 39441 FlyBaseID:FBgn0014343 Length:682 Species:Drosophila melanogaster
Sequence 2:NP_808263.2 Gene:Mkx / 210719 MGIID:2687286 Length:354 Species:Mus musculus


Alignment Length:158 Identity:55/158 - (34%)
Similarity:78/158 - (49%) Gaps:37/158 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 DQP---PFYANPAGIDLKENLVAGASPWPYPSMYHPYDAAFAGYPFNSYGMDLNGAR---RKNAT 232
            |.|   |....|.|..||:||          |:.|           ...|...||.:   ::.|.
Mouse    35 DNPHTGPEVGIPDGPPLKDNL----------SLRH-----------RRTGARQNGGKVRHKRQAL 78

  Fly   233 RETTSTLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLK---KENKMTWEPR- 293
            ::....||.||.:|:.||||||.|||:||:.::|||.|||.||||||||||   ::..::|..| 
Mouse    79 QDMARPLKQWLYKHRDNPYPTKTEKILLALGSQMTLVQVSNWFANARRRLKNTVRQPDLSWALRI 143

  Fly   294 ---NRVDDDDA---NIDDDDDKNTEDND 315
               |:....:|   ::..|.|..:||.:
Mouse   144 KLYNKYVQGNAERLSVSSDGDSCSEDGE 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mirrNP_001261778.1 Homeobox_KN 242..281 CDD:283551 26/38 (68%)
MkxNP_808263.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 18..50 5/14 (36%)
Homeobox_KN 88..127 CDD:368670 26/38 (68%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 157..183 4/15 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 243..302
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.