DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mirr and Pknox1

DIOPT Version :9

Sequence 1:NP_001261778.1 Gene:mirr / 39441 FlyBaseID:FBgn0014343 Length:682 Species:Drosophila melanogaster
Sequence 2:NP_057879.2 Gene:Pknox1 / 18771 MGIID:1201409 Length:436 Species:Mus musculus


Alignment Length:175 Identity:47/175 - (26%)
Similarity:69/175 - (39%) Gaps:49/175 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 PVSGQTICSCQYDMLNYQRLAAAGGVPLGVYPEG--MSAYLSGIAADQPPFYANPAG-------- 184
            ||..|.|.|.....|:.|.:.    ||.....:|  ..|.::|....||.....|.|        
Mouse   170 PVQSQQIQSAITGTLSPQGIV----VPASALQQGNVTMATVAGGTVYQPVTVVTPQGQVVTQALS 230

  Fly   185 ------------IDLKENLVAGASPWPYPSMYHPYDAAFAGYPFNSYGMDLNGARRKNATRETTS 237
                        :.|.::|          |:.|..|           |...|  :|....:..|:
Mouse   231 PGTIRIQNSQLQLQLNQDL----------SILHQED-----------GSSKN--KRGVLPKHATN 272

  Fly   238 TLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRL 282
            .:::||.:|..:||||:.||..:|..|.:||.||:.||.|||||:
Mouse   273 VMRSWLFQHIGHPYPTEDEKKQIAAQTNLTLLQVNNWFINARRRI 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mirrNP_001261778.1 Homeobox_KN 242..281 CDD:283551 20/38 (53%)
Pknox1NP_057879.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 23..50
Meis_PKNOX_N 80..165 CDD:374576
Homeobox_KN 277..316 CDD:368670 20/38 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 401..436
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.