DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mirr and Meis2

DIOPT Version :9

Sequence 1:NP_001261778.1 Gene:mirr / 39441 FlyBaseID:FBgn0014343 Length:682 Species:Drosophila melanogaster
Sequence 2:XP_011237639.1 Gene:Meis2 / 17536 MGIID:108564 Length:559 Species:Mus musculus


Alignment Length:376 Identity:90/376 - (23%)
Similarity:128/376 - (34%) Gaps:102/376 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 SAGLPALSLVGAPPPGPHSSAPG-GAPAPGAGNPPNRCCDTGRTIYTDPVSGQTICSCQYDMLNY 146
            |||.|      .|..|.|:|..| .:...||..     .:....:...|::.:|.| ....|...
Mouse   248 SAGTP------GPSSGGHASQSGDNSSEQGASE-----TEADHLLLWKPMTDRTGC-VSVQMSRE 300

  Fly   147 QRLAAAGG----VPLGVYPEGMSAYLSGIAADQPPFYA-NPAGIDLKENLVAGASPWPYPSMYHP 206
            .|..:..|    .||    |.:      |...||||.. :.||.|..:|.||.      |.....
Mouse   301 DREESREGKHSPQPL----ENI------IIPCQPPFRGESEAGGDGLDNSVAS------PGTGDD 349

  Fly   207 YDAAFAGYPFNSYGMDLNGARRKNA---TRETTSTLKAWLNEHKKNPYPTKGEKIMLAIITKMTL 268
            .|.            |.:..|:|..   .:..|:.::|||.:|..:|||::.:|..||..|.:|:
Mouse   350 DDP------------DKDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTI 402

  Fly   269 TQVSTWFANARRRLKKENKMTWEPRNRVDDDDANIDDDDDKNTEDNDLLDAKDSGVGSTDDKDRS 333
            .||:.||.|||||:                    :....|::.....|||...|...:...:.:.
Mouse   403 LQVNNWFINARRRI--------------------VQPMIDQSNRAGFLLDPSVSQGAAYSPEGQP 447

  Fly   334 GRLGDMMTD-------RPGESNNSEWSESRPGSPNGSPDLYDRPGSMPPGAHPLFHPAALHH--- 388
              :|..:.|       ||....:........|.|.|..  ..:|...||...|  ||..|.|   
Mouse   448 --MGSFVLDGQQHMGIRPAGLQSMPGDYVSQGGPMGMG--MAQPSYTPPQMTP--HPTQLRHGPP 506

  Fly   389 -------HFRPPA----GSPPDIAAYHHHQQQLLQQHQQAQQNSLQTAVGG 428
                   |...||    |.||.      |....:........||:...|||
Mouse   507 MHSYLPSHPHHPAMVMHGGPPT------HPGMTMSAQSPTMLNSVDPNVGG 551

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mirrNP_001261778.1 Homeobox_KN 242..281 CDD:283551 18/38 (47%)
Meis2XP_011237639.1 Meis_PKNOX_N 129..213 CDD:374576
Homeobox_KN 376..415 CDD:368670 18/38 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.