DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment caup and TGIF2LX

DIOPT Version :9

Sequence 1:NP_524046.2 Gene:caup / 39440 FlyBaseID:FBgn0015919 Length:693 Species:Drosophila melanogaster
Sequence 2:NP_620410.3 Gene:TGIF2LX / 90316 HGNCID:18570 Length:241 Species:Homo sapiens


Alignment Length:176 Identity:53/176 - (30%)
Similarity:83/176 - (47%) Gaps:29/176 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 RRKNATRESTATLKAWLSEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWE 293
            |:.|...||...|:.|:.:|:...||::.||.||:..|.::|.|:|.||.|||||:..:  |..:
Human    53 RKGNLPAESVKILRDWMYKHRFKAYPSEEEKQMLSEKTNLSLLQISNWFINARRRILPD--MLQQ 115

  Fly   294 PKNKTEDDDDGMMSDDEKEKDAGDGGKLSTEAFDPGNQ---------------LIKSELGKAEKE 343
            .:|      |.::. .:..|||......||||..|...               |.|.::.: ||:
Human   116 RRN------DPIIG-HKTGKDAHATHLQSTEASVPAKSGPSGPDNVQSLPLWPLPKGQMSR-EKQ 172

  Fly   344 VD--SSGDQKLDLDREPHNLVAMRGLAPYATPPGAHP-MHAAYSSY 386
            .|  |:..|||....:|...|.:...:| ::|....| .||.:||:
Human   173 PDPESAPSQKLTGIAQPKKKVKVSVTSP-SSPELVSPEEHADFSSF 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
caupNP_524046.2 Homeobox_KN 244..283 CDD:283551 17/38 (45%)
IRO 455..472 CDD:214716
TGIF2LXNP_620410.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..58 2/4 (50%)
Homeobox_KN 68..107 CDD:283551 17/38 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 126..210 22/85 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.