DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment caup and TOS8

DIOPT Version :9

Sequence 1:NP_524046.2 Gene:caup / 39440 FlyBaseID:FBgn0015919 Length:693 Species:Drosophila melanogaster
Sequence 2:NP_011419.1 Gene:TOS8 / 852783 SGDID:S000003064 Length:276 Species:Saccharomyces cerevisiae


Alignment Length:222 Identity:64/222 - (28%)
Similarity:92/222 - (41%) Gaps:47/222 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 VGGDV-PVGLSSAAQDL-PSRGSCCENGRPIITDPVSGQTVCSCQYDPARLAIGGYSRMALPSGG 147
            ||..| ||.:||....: ||.....:|...|:|..:.       ||.    .|...:|..:.:|.
Yeast    54 VGSPVNPVPVSSPVFFIGPSPQRSIQNHNAIMTQNIR-------QYP----VIYNNNREVISTGE 107

  Fly   148 VG-VGVYGGPYPSNEQNPYPSIGVDNSAFYAP--LSNPYGIKD-------TSP-----------S 191
            .. :...|||..::.|..|..|...|  ||..  |:.|:.:.:       |:|           |
Yeast   108 RNYIITVGGPPVTSSQPEYEHISTPN--FYQEQRLAQPHPVNESMMIGGYTNPQPISISRGKMLS 170

  Fly   192 TEMSAWTSASLQSTTGYYSYDPTLAAYGYGPNYDLAARRKNATRESTATLKAWLSEHKKNPYPTK 256
            ..:|  |::...|..||.:.:....|:|         :|.|..:.:.:.|..||.||..|||||.
Yeast   171 GNIS--TNSVRGSNNGYSAKEKKHKAHG---------KRSNLPKATVSILNKWLHEHVNNPYPTV 224

  Fly   257 GEKIMLAIITKMTLTQVSTWFANARRR 283
            .||..|...|.:|..|:|.||.|||||
Yeast   225 QEKRELLAKTGLTKLQISNWFINARRR 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
caupNP_524046.2 Homeobox_KN 244..283 CDD:283551 21/38 (55%)
IRO 455..472 CDD:214716
TOS8NP_011419.1 Homeobox_KN 212..251 CDD:399131 21/38 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.