DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment caup and HMRA2

DIOPT Version :9

Sequence 1:NP_524046.2 Gene:caup / 39440 FlyBaseID:FBgn0015919 Length:693 Species:Drosophila melanogaster
Sequence 2:NP_010020.1 Gene:HMRA2 / 850458 SGDID:S000000692 Length:119 Species:Saccharomyces cerevisiae


Alignment Length:100 Identity:27/100 - (27%)
Similarity:44/100 - (44%) Gaps:32/100 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 NYDLAARRKNA-------------------------TRESTATLKAWLSEHKKNPY-PTKG-EKI 260
            ||.|..:.|:|                         |:|:...|::|.:::.:||| .||| |.:
Yeast    10 NYQLTQKNKSADGLVFNVVTQDMINKSTKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENL 74

  Fly   261 MLAIITKMTLTQVSTWFANARRRLKKENKMTWEPK 295
            |..  |.::..|:..|.:|.||   ||..:|..|:
Yeast    75 MKN--TSLSRIQIKNWVSNRRR---KEKTITIAPE 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
caupNP_524046.2 Homeobox_KN 244..283 CDD:283551 14/40 (35%)
IRO 455..472 CDD:214716
HMRA2NP_010020.1 HOX 44..97 CDD:197696 19/57 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.