DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment caup and BLH4

DIOPT Version :10

Sequence 1:NP_524046.2 Gene:caup / 39440 FlyBaseID:FBgn0015919 Length:693 Species:Drosophila melanogaster
Sequence 2:NP_001324137.1 Gene:BLH4 / 816908 AraportID:AT2G23760 Length:679 Species:Arabidopsis thaliana


Alignment Length:115 Identity:24/115 - (20%)
Similarity:44/115 - (38%) Gaps:30/115 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 GDGKISVSELGNVFKSMGTSYTEEELN---------RVLDEIDIDCD-GFINQ---------EEF 77
            |.|..:...:..|:..:||...:.:|:         ..|:|:....: |.|.:         :..
plant  1233 GSGSTNPPVVSTVYAYIGTPPAQRQLSCLVWRLGPTHFLEEVLTAANVGIIYELGPNYVGSFQAV 1297

  Fly    78 ATICRSSSSAV----------EIREAFDLYDQNKNGLISSSEIHKVLNRL 117
            .|.|:.|.|..          |.:.:|.||..:.:.| :.:.|.||.|:|
plant  1298 CTPCKDSKSETGSLSLVSLVPEEKVSFGLYALSVSSL-TVARIRKVYNKL 1346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
caupNP_524046.2 Homeobox_KN 245..283 CDD:428673
IRO 455..472 CDD:214716
BLH4NP_001324137.1 POX 233..370 CDD:214728
Homeobox_KN <503..533 CDD:428673
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.