DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment caup and mkxa

DIOPT Version :9

Sequence 1:NP_524046.2 Gene:caup / 39440 FlyBaseID:FBgn0015919 Length:693 Species:Drosophila melanogaster
Sequence 2:NP_001092203.2 Gene:mkxa / 799136 ZFINID:ZDB-GENE-080513-1 Length:349 Species:Danio rerio


Alignment Length:160 Identity:51/160 - (31%)
Similarity:74/160 - (46%) Gaps:32/160 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 RKNATRESTATLKAWLSEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLK---KENKMT 291
            ::.|.::....||.||.:|:.||||||.|||:||:.::|||.|||.||||||||||   ::..::
Zfish    70 KRQALQDMARPLKQWLYKHRDNPYPTKTEKILLALGSQMTLVQVSNWFANARRRLKNTVRQPDLS 134

  Fly   292 WEPKNKTED------------DDDGMMSDDEKEKDAGDGGKLSTEAFDPGNQLIKSELGKAEKEV 344
            |..:.|..:            ..|...|||.........|:.|...:   ..:||.|.|.....:
Zfish   135 WALRIKLYNKYVQGNAERLSVSSDDSCSDDADPATRAQVGEFSKPMY---QSVIKKEGGGMGAGL 196

  Fly   345 DSSGDQKLDLDREPHNLVAMRGLAPYATPP 374
            .::.|..|..|              |.:||
Zfish   197 RAASDASLADD--------------YVSPP 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
caupNP_524046.2 Homeobox_KN 244..283 CDD:283551 26/38 (68%)
IRO 455..472 CDD:214716
mkxaNP_001092203.2 Homeobox_KN 84..123 CDD:283551 26/38 (68%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.