DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment caup and pknox1.1

DIOPT Version :9

Sequence 1:NP_524046.2 Gene:caup / 39440 FlyBaseID:FBgn0015919 Length:693 Species:Drosophila melanogaster
Sequence 2:NP_571966.3 Gene:pknox1.1 / 798151 ZFINID:ZDB-GENE-020122-5 Length:433 Species:Danio rerio


Alignment Length:278 Identity:68/278 - (24%)
Similarity:104/278 - (37%) Gaps:90/278 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 GGPY-PSNEQ--NPYPSIGVDNSAFYAPLSNPYGIKDTSPSTEMSAWTSASLQST---TGYYSYD 212
            |.|| |.::|  ||          |..||| |..:...|...:..:.|..::.|:   ||...|.
Zfish   167 GSPYSPVHDQLSNP----------FSGPLS-PQSLLIPSSGLQQGSVTVTTVNSSQVATGNTVYQ 220

  Fly   213 PTLAAYGYGP----------------------NYDLA----------ARRKNATRESTATLKAWL 245
            |.......|.                      |.||:          .:|....:::|..:::||
Zfish   221 PVTVVTPQGQVVTQAISPGALHIQNSQLQLQLNQDLSFFGGDDSSPKNKRGVLPKQATNVMRSWL 285

  Fly   246 SEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRL-------------KKENKMTW-EPKN 296
            .:|..:||||:.||..:|..|.:||.||:.||.|||||:             |.:.|:.. .|.:
Zfish   286 FQHIAHPYPTEEEKKQIATQTNLTLLQVNNWFINARRRILQPMLDANSTEASKSKKKVAQSRPLH 350

  Fly   297 KTEDDD-------------DGM-----MSDDEKEKDAGDGGKLSTEAFDPGNQLIKSELGKAEKE 343
            :...|.             ||.     |:.|..:..:.||..|:.:....||.        :|.|
Zfish   351 RFWSDSIASTGSQQQLTMPDGSLVTVGMNVDGFQALSSDGATLAMQQVLMGNH--------SEDE 407

  Fly   344 VDSSGDQKLDLDREPHNL 361
            .|.||::. |.|....|:
Zfish   408 TDESGNED-DTDMSTANM 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
caupNP_524046.2 Homeobox_KN 244..283 CDD:283551 20/38 (53%)
IRO 455..472 CDD:214716
pknox1.1NP_571966.3 Meis_PKNOX_N 82..166 CDD:293102
Homeobox_KN 284..323 CDD:283551 20/38 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.