DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment caup and TGIF1

DIOPT Version :9

Sequence 1:NP_524046.2 Gene:caup / 39440 FlyBaseID:FBgn0015919 Length:693 Species:Drosophila melanogaster
Sequence 2:NP_775299.1 Gene:TGIF1 / 7050 HGNCID:11776 Length:286 Species:Homo sapiens


Alignment Length:299 Identity:77/299 - (25%)
Similarity:102/299 - (34%) Gaps:87/299 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 RRKNATRESTATLKAWLSEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWE 293
            ||.|..:||...|:.||.||:.|.||::.||.:|:..|.::..||..||.||||||..:      
Human    52 RRGNLPKESVQILRDWLYEHRYNAYPSEQEKALLSQQTHLSTLQVCNWFINARRRLLPD------ 110

  Fly   294 PKNKTEDDDDGMMSDDEKEKDAGDGGKLSTEAFDPGNQLIKSELGKAEKEVDS----SGDQKL-- 352
                       |:..|.|               || ||...|..|....|..|    .|.:..  
Human   111 -----------MLRKDGK---------------DP-NQFTISRRGAKISETSSVESVMGIKNFMP 148

  Fly   353 DLDREP-HNLVA------MRGLAPYATPPG---AHPMHAAYSSYAQSHNTHTHPHPQQMQHHQQQ 407
            .|:..| |:..|      .|.|:|..:.||   |.|.       ...|.|.|             
Human   149 ALEETPFHSCTAGPNPTLGRPLSPKPSSPGSVLARPS-------VICHTTVT------------- 193

  Fly   408 QQQQQNQQQLQHHQMDQPY--YHPGGYGQEESGEFAAQKNPLSRDCGIPVPASKPKIWSVADTAA 470
                        ...|.|:  ....|.||....:..|.||........|....|....:...:..
Human   194 ------------ALKDVPFSLCQSVGVGQNTDIQQIAAKNFTDTSLMYPEDTCKSGPSTNTQSGL 246

  Fly   471 CKTPPPTAAYLGQNFYPPSSADQQLPHQPLQQHQQQQLQ 509
            ..|||||...|.|:|    |..|.|....|::..:.:||
Human   247 FNTPPPTPPDLNQDF----SGFQLLVDVALKRAAEMELQ 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
caupNP_524046.2 Homeobox_KN 244..283 CDD:283551 18/38 (47%)
IRO 455..472 CDD:214716 1/16 (6%)
TGIF1NP_775299.1 Homeobox_KN 67..106 CDD:283551 18/38 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.