DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment caup and MEIS3

DIOPT Version :9

Sequence 1:NP_524046.2 Gene:caup / 39440 FlyBaseID:FBgn0015919 Length:693 Species:Drosophila melanogaster
Sequence 2:XP_024307380.1 Gene:MEIS3 / 56917 HGNCID:29537 Length:509 Species:Homo sapiens


Alignment Length:283 Identity:64/283 - (22%)
Similarity:92/283 - (32%) Gaps:127/283 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 YPSNEQNPYPSIGVDNSAFYAPLSNPYGIKDTSPSTEMSAWT----SASLQSTTGYYSYD----- 212
            ||::    .||:         |..|...|:|...|..:...|    |..|.|.:|..|.|     
Human   277 YPAS----CPSL---------PDQNNMWIRDHEDSGSVHLGTPGPSSGGLASQSGDNSSDQGDGL 328

  Fly   213 --PTLAAYGYGPNYDL-AARRKNATR-----ESTATLKAWLSEH--------------------- 248
              ...:....|.:.|| ..||:|..|     .:|..::|||.:|                     
Human   329 DTSVASPSSGGEDEDLDQERRRNKKRGIFPKVATNIMRAWLFQHLSRRSEAPVLPDVCLGLGSPS 393

  Fly   249 -------------------------KKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKEN 288
                                     .::|||::.:|..||..|.:|:.||:.||.|||||:.:. 
Human   394 PGPRWARPWGSDCGRPGRQSDSCWWLQHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQP- 457

  Fly   289 KMTWEPKNKTEDDDDGMMSDDEKEKDAGDGGKLSTEAFDPGNQLIKSELGKAEKEVDSSGDQKLD 353
              ..:..|:|                 |.|.     ||.|..|.|.   |..|            
Human   458 --MIDQSNRT-----------------GQGA-----AFSPEGQPIG---GYTE------------ 483

  Fly   354 LDREPHNLVAMRGLAPYATPPGA 376
              .:||  ||:|       |||:
Human   484 --TQPH--VAVR-------PPGS 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
caupNP_524046.2 Homeobox_KN 244..283 CDD:283551 18/84 (21%)
IRO 455..472 CDD:214716
MEIS3XP_024307380.1 Meis_PKNOX_N 184..267 CDD:318653
Homeobox_KN 417..453 CDD:310480 15/35 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.