DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment caup and PKNOX1

DIOPT Version :9

Sequence 1:NP_524046.2 Gene:caup / 39440 FlyBaseID:FBgn0015919 Length:693 Species:Drosophila melanogaster
Sequence 2:NP_004562.2 Gene:PKNOX1 / 5316 HGNCID:9022 Length:436 Species:Homo sapiens


Alignment Length:239 Identity:56/239 - (23%)
Similarity:85/239 - (35%) Gaps:74/239 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 LSSAAQDLPSRGSCC-------------ENGRPIITDPVSGQTVCSC---QYDPARLAIGGYSRM 141
            ::...:|..||...|             |.|.|.  .||..|.:.|.   ...|..:.:   ...
Human   135 VNELCKDFCSRYIACLKTKMNSETLLSGEPGSPY--SPVQSQQIQSAITGTISPQGIVV---PAS 194

  Fly   142 ALPSGGVGVGVYGGPYPSNEQNPYPSIGVDNSAFYAPLS--NPYG---IKDTSPSTEMSAWTSAS 201
            ||..|.|.:....|                 ...|.|::  .|.|   .:..||.|.....:...
Human   195 ALQQGNVAMATVAG-----------------GTVYQPVTVVTPQGQVVTQTLSPGTIRIQNSQLQ 242

  Fly   202 LQSTTGYYSYDPTLAAYGYGPNYDLAA----------RRKNATRESTATLKAWLSEHKKNPYPTK 256
            ||.                  |.||:.          :|....:.:|..:::||.:|..:||||:
Human   243 LQL------------------NQDLSILHQDDGSSKNKRGVLPKHATNVMRSWLFQHIGHPYPTE 289

  Fly   257 GEKIMLAIITKMTLTQVSTWFANARRRLKK---ENKMTWEPKNK 297
            .||..:|..|.:||.||:.||.|||||:.:   ::..:..||.|
Human   290 DEKKQIAAQTNLTLLQVNNWFINARRRILQPMLDSSCSETPKTK 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
caupNP_524046.2 Homeobox_KN 244..283 CDD:283551 20/38 (53%)
IRO 455..472 CDD:214716
PKNOX1NP_004562.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..49
Meis_PKNOX_N 80..165 CDD:406806 5/29 (17%)
Homeobox_KN 277..316 CDD:399131 20/38 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 401..436
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.