DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment caup and Tgif2

DIOPT Version :9

Sequence 1:NP_524046.2 Gene:caup / 39440 FlyBaseID:FBgn0015919 Length:693 Species:Drosophila melanogaster
Sequence 2:NP_001128455.1 Gene:Tgif2 / 499929 RGDID:1560115 Length:237 Species:Rattus norvegicus


Alignment Length:326 Identity:74/326 - (22%)
Similarity:107/326 - (32%) Gaps:121/326 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 RRKNATRESTATLKAWLSEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWE 293
            ||.|..:||...|:.||..|:.|.||::.||:.|:..|.:::.|:..||.||||||..:      
  Rat    21 RRGNLPKESVKILRDWLYLHRYNAYPSEQEKLSLSGQTNLSVLQICNWFINARRRLLPD------ 79

  Fly   294 PKNKTEDDDDGMMSDDEKEKDAGDGGKLSTEAFDPGNQLIKSELGKAEKEVDSSGDQKLDLDREP 358
                       |:..|.|               ||....|....|||                  
  Rat    80 -----------MLRKDGK---------------DPNQFTISRRGGKA------------------ 100

  Fly   359 HNLVAMRGLAPYATPPGAHPMHAAYSSYAQSHNTHTHPHPQQMQHHQQQQQQQQNQQQLQHHQMD 423
                     :..|.|.|:.|...|.|.          |.|..|               |......
  Rat   101 ---------SDVALPRGSSPSLLAVSV----------PAPTNM---------------LSLSVCS 131

  Fly   424 QPYYHPGGYGQEESGEFAAQKNPLSRDCGIPVPASKPKIWSVADTAA-----CKTPPPTAAYLGQ 483
            .|.:  .|.|::.:..|...:  |.....:..|.|...:.:.|:..:     ..|||||      
  Rat   132 MPLH--SGQGEKPAASFPQVE--LESPKALVTPGSTLTLLTRAEAGSPTGGLFNTPPPT------ 186

  Fly   484 NFYPPS------SADQQLPHQPLQQHQQQQLQQLQQQQQHHHHPHHHHPHHSMELGSPLSMMSSY 542
               ||.      |:.|.|....||:..:.:|    |:||....|..|         :||.::|..
  Rat   187 ---PPEQDKDDFSSFQLLVEVALQRAAEMEL----QKQQDPAPPLLH---------TPLPLVSEN 235

  Fly   543 A 543
            |
  Rat   236 A 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
caupNP_524046.2 Homeobox_KN 244..283 CDD:283551 16/38 (42%)
IRO 455..472 CDD:214716 3/21 (14%)
Tgif2NP_001128455.1 Homeobox_KN 36..75 CDD:399131 16/38 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.