Sequence 1: | NP_524046.2 | Gene: | caup / 39440 | FlyBaseID: | FBgn0015919 | Length: | 693 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_705940.1 | Gene: | pknox2 / 386959 | ZFINID: | ZDB-GENE-031118-112 | Length: | 474 | Species: | Danio rerio |
Alignment Length: | 309 | Identity: | 63/309 - (20%) |
---|---|---|---|
Similarity: | 105/309 - (33%) | Gaps: | 136/309 - (44%) |
- Green bases have known domain annotations that are detailed below.
Fly 154 GGPYPSNE----------QNPYPSI-----GVDNSAFYAPLSNPYGIKDTSPSTEMSAWTSASLQ 203
Fly 204 STTGYYSYDPTLAAYGYGP------------------NYDLAA-------RRKN----ATRESTA 239
Fly 240 TLKAWLSEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRR-------------------LK 285
Fly 286 KENKMT---W-----------------------------------------------------EP 294
Fly 295 KNKTEDDDDGMMSDDEKEKDAGDGGKLSTEAFDPGNQLIKSELGKAEKE 343 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
caup | NP_524046.2 | Homeobox_KN | 244..283 | CDD:283551 | 20/38 (53%) |
IRO | 455..472 | CDD:214716 | |||
pknox2 | NP_705940.1 | Meis_PKNOX_N | 95..178 | CDD:293102 | |
Homeobox_KN | 306..345 | CDD:283551 | 20/38 (53%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0773 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |