DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment caup and Tgif1

DIOPT Version :9

Sequence 1:NP_524046.2 Gene:caup / 39440 FlyBaseID:FBgn0015919 Length:693 Species:Drosophila melanogaster
Sequence 2:NP_001015020.1 Gene:Tgif1 / 316742 RGDID:1310517 Length:287 Species:Rattus norvegicus


Alignment Length:294 Identity:75/294 - (25%)
Similarity:103/294 - (35%) Gaps:77/294 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 RRKNATRESTATLKAWLSEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWE 293
            ||.|..:||...|:.||.||:.|.||::.||.:|:..|.::..||..||.||||||..:      
  Rat    53 RRGNLPKESVQILRDWLYEHRYNAYPSEQEKALLSQQTHLSTLQVCNWFINARRRLLPD------ 111

  Fly   294 PKNKTEDDDDGMMSDDEKEKDAGDGGKLSTEAFDPGNQLIKSELGKAEKEVDS----SGDQKL-- 352
                       |:..|.|               || ||...|..|....|..|    .|.:..  
  Rat   112 -----------MLRKDGK---------------DP-NQFTISRRGAKISEASSIEAAMGIKNFMP 149

  Fly   353 DLDREP-HNLVA------MRGLAPYATPPGAHPMHAAYSSYAQSHNTHTHPHPQQMQHHQQQQQQ 410
            .|:..| |:.|.      .|.::|  .||...|:.|..|....:..|.....|..:.........
  Rat   150 TLEESPFHSCVVGPNPTLGRPVSP--KPPSPGPILARPSVICHTTVTALKDGPFSLCQAVSVGHS 212

  Fly   411 QQNQQQLQHHQMDQPYYHPGGYGQEESGEFAAQKNPLSRDCGIPVPASKPKIWSVADTAACKTPP 475
            ...||....:..|....:|     |::.:.....||.|                    ....|||
  Rat   213 TDVQQVAPSNFTDASLRYP-----EDTCKSGPSPNPQS--------------------GLFNTPP 252

  Fly   476 PTAAYLGQNFYPPSSADQQLPHQPLQQHQQQQLQ 509
            ||...|.|:|    |..|.|....|:|..:.:||
  Rat   253 PTPPDLNQDF----SGFQLLVDVALKQAAEMELQ 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
caupNP_524046.2 Homeobox_KN 244..283 CDD:283551 18/38 (47%)
IRO 455..472 CDD:214716 0/16 (0%)
Tgif1NP_001015020.1 Homeobox_KN 68..107 CDD:283551 18/38 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.