DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment caup and Meis2

DIOPT Version :9

Sequence 1:NP_524046.2 Gene:caup / 39440 FlyBaseID:FBgn0015919 Length:693 Species:Drosophila melanogaster
Sequence 2:XP_038960864.1 Gene:Meis2 / 311311 RGDID:1305198 Length:496 Species:Rattus norvegicus


Alignment Length:483 Identity:104/483 - (21%)
Similarity:157/483 - (32%) Gaps:144/483 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 GGSTATGLTAG----PLSPGAVSQSSH-------HAGHKGLSTSPAEDVVGGDVPVGLSSAAQDL 100
            ||....|:.|.    |.:|..:....|       ||.....:.:|..:|    :|..:.||..|.
  Rat    31 GGMDGVGVPASMYGDPHAPRPIPPVHHLNHGPPLHATQHYGAHAPHPNV----MPASMGSAVNDA 91

  Fly   101 PSRGSCCENGRPIITDPVSGQTVCSCQY---DPARLAIGGYSRMALPSGGVGVGVYG----GPYP 158
            ..|......|.|:.  |:.......|:.   .|....:.|....:..|....:.|:.    ...|
  Rat    92 LKRDKDAIYGHPLF--PLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQVRAEKP 154

  Fly   159 SNEQNPYPSIGVDNSAFYA---------------------------------PLSNPYGIKDTS- 189
            ....||    .:||....|                                 |:......:|.| 
  Rat   155 LFSSNP----ELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSS 215

  Fly   190 ---------PSTEM-----SAW------TSASLQSTTGYYS-----------------YDPTLAA 217
                     .||.:     |:|      ||.....|.|..|                 .|.::|:
  Rat   216 KSDHEELSGSSTNLADHNPSSWRDHDDATSTHSAGTPGPSSGGHASQSGDNSSEQGDGLDNSVAS 280

  Fly   218 YGYG----PNYDLAARRKNATRESTAT--LKAWLSEHKKNPYPTKGEKIMLAIITKMTLTQVSTW 276
            .|.|    |:.|...::|.......||  ::|||.:|..:|||::.:|..||..|.:|:.||:.|
  Rat   281 PGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNW 345

  Fly   277 FANARRRLKKENKMTWEPKNKTEDDDDGMMSDDEKEKDAGDGGKLSTEAFDPGNQLIKSELGKAE 341
            |.|||||:.:.   ..:..|:.     |.:.|....:.|         |:.|..|.:.|.:    
  Rat   346 FINARRRIVQP---MIDQSNRA-----GFLLDPSVSQGA---------AYSPEGQPMGSFV---- 389

  Fly   342 KEVDSSGDQKLDLDREPHNLVAMRGLAPYATPPGAHPMHAAYSSYAQSHNTHTHPHPQQMQH--- 403
                ..|.|.:.:  .|..|.:|.|  .|.:..|...|..|..||.....|   |||.|::|   
  Rat   390 ----LDGQQHMGI--RPAGLQSMPG--DYVSQGGPVGMGMAQPSYTPPQMT---PHPTQLRHGPP 443

  Fly   404 -HQQQQQQQQNQQQLQHHQMDQPYYHPG 430
             |........:...:.|   ..|..|||
  Rat   444 MHSYLPSHPHHPAMMMH---GGPPTHPG 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
caupNP_524046.2 Homeobox_KN 244..283 CDD:283551 18/38 (47%)
IRO 455..472 CDD:214716
Meis2XP_038960864.1 Meis_PKNOX_N 129..213 CDD:406806 10/87 (11%)
Homeobox_KN 313..352 CDD:399131 18/38 (47%)
PAT1 <354..>482 CDD:401645 32/150 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.