DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment caup and meis2b

DIOPT Version :9

Sequence 1:NP_524046.2 Gene:caup / 39440 FlyBaseID:FBgn0015919 Length:693 Species:Drosophila melanogaster
Sequence 2:NP_570985.1 Gene:meis2b / 30066 ZFINID:ZDB-GENE-000210-23 Length:393 Species:Danio rerio


Alignment Length:238 Identity:56/238 - (23%)
Similarity:92/238 - (38%) Gaps:44/238 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 SCCENGRPI--ITDPVSGQTVCSCQYDPARLAIGGYSRMALPSGGVGVGVYGGPYPSNEQNPYPS 167
            ||.:...||  :.|...|   |...:|...   |..:.:|                  :.||...
Zfish   179 SCLKGKMPIDLVIDERDG---CKSDFDDLS---GSSTNLA------------------DHNPASW 219

  Fly   168 IGVDNSAFYAPLSNPYGIKDTSPSTEMSAWTSASLQSTTGYYSYDPTLAAYGYGPNYDLAARRKN 232
            ..:|::.....:..|      .||:...|..|....|..| ...|.:||:.|.|...|...:|:.
Zfish   220 RDMDDAHSTPSVGTP------GPSSGGHASQSGDNSSELG-DGLDNSLASPGTGDEDDQDKKRQK 277

  Fly   233 A----TRESTATLKAWLSEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRR-----LKKEN 288
            .    .:.:|..::|||.:|..:|||::.:|..||..|.:|..||:.||.|||||     :.:.|
Zfish   278 KRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTNLQVNNWFINARRRIVQPMIDQSN 342

  Fly   289 KMTWEPKNKTEDDD--DGMMSDDEKEKDAGDGGKLSTEAFDPG 329
            :...:....:.|..  .|.:.|.::......||.:.....:.|
Zfish   343 RAVSQGTAYSPDGQPMGGFVLDGQQHMGLRPGGPMGGMGMNMG 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
caupNP_524046.2 Homeobox_KN 244..283 CDD:283551 18/38 (47%)
IRO 455..472 CDD:214716
meis2bNP_570985.1 Meis_PKNOX_N 112..195 CDD:293102 5/15 (33%)
Homeobox_KN 293..332 CDD:283551 18/38 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.