DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment caup and Mkx

DIOPT Version :10

Sequence 1:NP_524046.2 Gene:caup / 39440 FlyBaseID:FBgn0015919 Length:693 Species:Drosophila melanogaster
Sequence 2:NP_808263.2 Gene:Mkx / 210719 MGIID:2687286 Length:354 Species:Mus musculus


Alignment Length:109 Identity:23/109 - (21%)
Similarity:48/109 - (44%) Gaps:20/109 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 STNKSTTPSTDMELKKVFDKFDANGDGKISVSELGNVFKSMGTSYTEEELNRVLDEIDID----- 67
            :|.:|.|..|..|...:..:     .|.:::|.|.:|.:|:  :.....:.|:|.|..::     
Mouse   426 TTYRSYTEETSYENSLLVQQ-----TGALALSSLTHVLRSL--TPNARGIFRLLAEFQLENKDNP 483

  Fly    68 CDGFINQEEFATICRSS---SSAVEIR-EAFDLYD----QNKNG 103
            ....::.::|...||.|   :|.:.:| :..:..|    :||.|
Mouse   484 AYSGLSFQDFYQRCRESFLVNSDITLRTQLTEFRDHKLIRNKKG 527

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
caupNP_524046.2 Homeobox_KN 245..283 CDD:428673
IRO 455..472 CDD:214716
MkxNP_808263.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 18..50
Homeobox_KN 89..127 CDD:428673
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 157..183
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 243..302
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.