DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment caup and Mkx

DIOPT Version :9

Sequence 1:NP_524046.2 Gene:caup / 39440 FlyBaseID:FBgn0015919 Length:693 Species:Drosophila melanogaster
Sequence 2:NP_808263.2 Gene:Mkx / 210719 MGIID:2687286 Length:354 Species:Mus musculus


Alignment Length:209 Identity:63/209 - (30%)
Similarity:89/209 - (42%) Gaps:64/209 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 LSNPY-----GIKDTSPSTEMSAWTSASLQSTTGYYSYDPTLAAYGYGPNYDLAARRKNATREST 238
            |.||:     ||.|..|..:     :.||:.           ...|...|......::.|.::..
Mouse    34 LDNPHTGPEVGIPDGPPLKD-----NLSLRH-----------RRTGARQNGGKVRHKRQALQDMA 82

  Fly   239 ATLKAWLSEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLK---KENKMTWEPKNKTED 300
            ..||.||.:|:.||||||.|||:||:.::|||.|||.||||||||||   ::..::|..:.|.. 
Mouse    83 RPLKQWLYKHRDNPYPTKTEKILLALGSQMTLVQVSNWFANARRRLKNTVRQPDLSWALRIKLY- 146

  Fly   301 DDDGMMSDDEKEKDAGDGGKLSTEAFDPGNQLIKSELGKAEK-EVDSSGDQ-KLDLDREPHNLVA 363
                                         |:.::   |.||: .|.|.||. ..|.:..|.|.:.
Mouse   147 -----------------------------NKYVQ---GNAERLSVSSDGDSCSEDGENPPRNHMN 179

  Fly   364 MRGLAPYATPPGAH 377
            ..|   |:||  ||
Mouse   180 EEG---YSTP--AH 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
caupNP_524046.2 Homeobox_KN 244..283 CDD:283551 26/38 (68%)
IRO 455..472 CDD:214716
MkxNP_808263.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 18..50 6/15 (40%)
Homeobox_KN 88..127 CDD:368670 26/38 (68%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 157..183 8/28 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 243..302
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.