DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment caup and Meis3

DIOPT Version :9

Sequence 1:NP_524046.2 Gene:caup / 39440 FlyBaseID:FBgn0015919 Length:693 Species:Drosophila melanogaster
Sequence 2:XP_036008636.1 Gene:Meis3 / 17537 MGIID:108519 Length:400 Species:Mus musculus


Alignment Length:204 Identity:59/204 - (28%)
Similarity:86/204 - (42%) Gaps:56/204 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 GDVPVGLSSAAQDLPSRGSCCENGRPIITDPVSGQTVCSCQYDPARLAIGGYSRMALPSGGVGVG 151
            |.:|:.|....:|    |||.|:    :.|     ...||...|.:...  :.|....||.|.:|
Mouse   192 GKMPIDLVIEDRD----GSCRED----LED-----YAASCPSLPDQNTT--WIRDHEDSGSVHLG 241

  Fly   152 VYGGPYPSNEQNPYPSIGVDNSAFYAPLSNPYGIKDTSPSTEMSAWTSASLQSTTGYYSYDPTLA 216
            .   |.||:  ....|...|||:     ....|: |||.::..||                    
Mouse   242 T---PGPSS--GGLASQSGDNSS-----DQGDGL-DTSVASPSSA-------------------- 275

  Fly   217 AYGYGPNYDL-AARRKNATR-----ESTATLKAWLSEHKKNPYPTKGEKIMLAIITKMTLTQVST 275
                |.:.|| ..||:|..|     .:|..::|||.:|..:|||::.:|..||..|.:|:.||:.
Mouse   276 ----GEDEDLDLERRRNKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNN 336

  Fly   276 WFANARRRL 284
            ||.|||||:
Mouse   337 WFINARRRI 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
caupNP_524046.2 Homeobox_KN 244..283 CDD:283551 18/38 (47%)
IRO 455..472 CDD:214716
Meis3XP_036008636.1 Meis_PKNOX_N 99..205 CDD:406806 4/16 (25%)
Homeobox_KN 305..344 CDD:399131 18/38 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.