Sequence 1: | NP_524046.2 | Gene: | caup / 39440 | FlyBaseID: | FBgn0015919 | Length: | 693 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_036008636.1 | Gene: | Meis3 / 17537 | MGIID: | 108519 | Length: | 400 | Species: | Mus musculus |
Alignment Length: | 204 | Identity: | 59/204 - (28%) |
---|---|---|---|
Similarity: | 86/204 - (42%) | Gaps: | 56/204 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 87 GDVPVGLSSAAQDLPSRGSCCENGRPIITDPVSGQTVCSCQYDPARLAIGGYSRMALPSGGVGVG 151
Fly 152 VYGGPYPSNEQNPYPSIGVDNSAFYAPLSNPYGIKDTSPSTEMSAWTSASLQSTTGYYSYDPTLA 216
Fly 217 AYGYGPNYDL-AARRKNATR-----ESTATLKAWLSEHKKNPYPTKGEKIMLAIITKMTLTQVST 275
Fly 276 WFANARRRL 284 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
caup | NP_524046.2 | Homeobox_KN | 244..283 | CDD:283551 | 18/38 (47%) |
IRO | 455..472 | CDD:214716 | |||
Meis3 | XP_036008636.1 | Meis_PKNOX_N | 99..205 | CDD:406806 | 4/16 (25%) |
Homeobox_KN | 305..344 | CDD:399131 | 18/38 (47%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0773 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.900 |