DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment caup and Meis2

DIOPT Version :10

Sequence 1:NP_524046.2 Gene:caup / 39440 FlyBaseID:FBgn0015919 Length:693 Species:Drosophila melanogaster
Sequence 2:XP_011237639.1 Gene:Meis2 / 17536 MGIID:108564 Length:559 Species:Mus musculus


Alignment Length:103 Identity:20/103 - (19%)
Similarity:38/103 - (36%) Gaps:24/103 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 KISVSELGNVFKSMGTSYTEEELNRVLDEIDIDCDGFINQEEFATICRSSSSAVEIREAFDLYDQ 99
            |.::...||..:.. |.:..|.||       :...|....||:..:...:.:.:.:.||..|.  
Mouse   254 KANILVSGNEIRQF-TRFMTERLN-------VSHAGAPLGEEYILVFSRTQNRLILNEAELLL-- 308

  Fly   100 NKNGLISSSEIHKVLNRLGMTCSVE-----DCVRMIGH 132
                     |:.:......:|.|:|     |.||::.:
Mouse   309 ---------ELAQEFQMKTVTVSLEDHTFADVVRLVSN 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
caupNP_524046.2 Homeobox_KN 245..283 CDD:428673
IRO 455..472 CDD:214716
Meis2XP_011237639.1 Meis_PKNOX_N 129..213 CDD:465140
Homeobox_KN 377..415 CDD:428673
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.