DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment caup and LOC1269377

DIOPT Version :10

Sequence 1:NP_524046.2 Gene:caup / 39440 FlyBaseID:FBgn0015919 Length:693 Species:Drosophila melanogaster
Sequence 2:XP_061504336.1 Gene:LOC1269377 / 1269377 VectorBaseID:AGAMI1_010406 Length:150 Species:Anopheles gambiae


Alignment Length:72 Identity:28/72 - (38%)
Similarity:42/72 - (58%) Gaps:6/72 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   219 GYGPNYDLAARRKNATRE------STATLKAWLSEHKKNPYPTKGEKIMLAIITKMTLTQVSTWF 277
            |.|...|..:.:||..:.      :|..|:|||.:|..:|||::.:|..||..|.:|:.||:.||
Mosquito    17 GTGEEDDDTSGKKNQKKRGIFPKVATNILRAWLFQHLTHPYPSEDQKKQLAQDTGLTILQVNNWF 81

  Fly   278 ANARRRL 284
            .|||||:
Mosquito    82 INARRRI 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
caupNP_524046.2 Homeobox_KN 245..283 CDD:428673 17/37 (46%)
IRO 455..472 CDD:214716
LOC1269377XP_061504336.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.