Sequence 1: | NP_524046.2 | Gene: | caup / 39440 | FlyBaseID: | FBgn0015919 | Length: | 693 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001136222.1 | Gene: | Tgif2lx2 / 100039551 | MGIID: | 3800824 | Length: | 231 | Species: | Mus musculus |
Alignment Length: | 199 | Identity: | 47/199 - (23%) |
---|---|---|---|
Similarity: | 93/199 - (46%) | Gaps: | 27/199 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 236 ESTATLKAWLSEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWEPKNKTED 300
Fly 301 -DDDGMMSDDEKEKDAGDGGKLSTEAFDPGNQL------IKSELGKAEKEVDSSGDQKL----DL 354
Fly 355 DREPHNLVAMRGLAPYATPPGAHPMHAA-YSSYAQSHNTHTHPHPQQMQHHQQQQQQQQNQQQLQ 418
Fly 419 HHQM 422 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
caup | NP_524046.2 | Homeobox_KN | 244..283 | CDD:283551 | 19/38 (50%) |
IRO | 455..472 | CDD:214716 | |||
Tgif2lx2 | NP_001136222.1 | Homeobox_KN | 56..94 | CDD:283551 | 18/37 (49%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0773 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |