DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment caup and Tgif2lx2

DIOPT Version :9

Sequence 1:NP_524046.2 Gene:caup / 39440 FlyBaseID:FBgn0015919 Length:693 Species:Drosophila melanogaster
Sequence 2:NP_001136222.1 Gene:Tgif2lx2 / 100039551 MGIID:3800824 Length:231 Species:Mus musculus


Alignment Length:199 Identity:47/199 - (23%)
Similarity:93/199 - (46%) Gaps:27/199 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 ESTATLKAWLSEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWEPKNKTED 300
            :|...|:.||.||:.|.|||..:|.||:..|.::..|||.||.|.|:.|:      ||.:.|...
Mouse    48 KSVKILRDWLCEHQFNAYPTVADKRMLSKNTDLSYLQVSNWFVNIRKHLR------WEIRYKPYS 106

  Fly   301 -DDDGMMSDDEKEKDAGDGGKLSTEAFDPGNQL------IKSELGKAEKEVDSSGDQKL----DL 354
             ..:|..::..:::.:....::.|: |:....:      |:.:..:....::||.:||:    ::
Mouse   107 LSHEGQAANAAQKQHSNPSEEVKTQ-FNENADMQDLPLPIRQDSEEKVPYLESSPNQKVIAEDNI 170

  Fly   355 DREPHNLVAMRGLAPYATPPGAHPMHAA-YSSYAQSHNTHTHPHPQQMQHHQQQQQQQQNQQQLQ 418
            ::|....:.    .|:::|..|.|.... :||:....:...    |:.:..::|::|..|.|..|
Mouse   171 EKEEKISIT----EPWSSPEVAWPEEKPDFSSFYMLVDVAV----QKAKEMEEQKKQNPNPQGPQ 227

  Fly   419 HHQM 422
            ...|
Mouse   228 QQFM 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
caupNP_524046.2 Homeobox_KN 244..283 CDD:283551 19/38 (50%)
IRO 455..472 CDD:214716
Tgif2lx2NP_001136222.1 Homeobox_KN 56..94 CDD:283551 18/37 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.