DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment caup and Tgif2lx2

DIOPT Version :10

Sequence 1:NP_524046.2 Gene:caup / 39440 FlyBaseID:FBgn0015919 Length:693 Species:Drosophila melanogaster
Sequence 2:NP_001136222.1 Gene:Tgif2lx2 / 100039551 MGIID:3800824 Length:231 Species:Mus musculus


Alignment Length:199 Identity:47/199 - (23%)
Similarity:93/199 - (46%) Gaps:27/199 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 ESTATLKAWLSEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWEPKNKTED 300
            :|...|:.||.||:.|.|||..:|.||:..|.::..|||.||.|.|:.|:      ||.:.|...
Mouse    48 KSVKILRDWLCEHQFNAYPTVADKRMLSKNTDLSYLQVSNWFVNIRKHLR------WEIRYKPYS 106

  Fly   301 -DDDGMMSDDEKEKDAGDGGKLSTEAFDPGNQL------IKSELGKAEKEVDSSGDQKL----DL 354
             ..:|..::..:::.:....::.|: |:....:      |:.:..:....::||.:||:    ::
Mouse   107 LSHEGQAANAAQKQHSNPSEEVKTQ-FNENADMQDLPLPIRQDSEEKVPYLESSPNQKVIAEDNI 170

  Fly   355 DREPHNLVAMRGLAPYATPPGAHPMHAA-YSSYAQSHNTHTHPHPQQMQHHQQQQQQQQNQQQLQ 418
            ::|....:.    .|:::|..|.|.... :||:....:...    |:.:..::|::|..|.|..|
Mouse   171 EKEEKISIT----EPWSSPEVAWPEEKPDFSSFYMLVDVAV----QKAKEMEEQKKQNPNPQGPQ 227

  Fly   419 HHQM 422
            ...|
Mouse   228 QQFM 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
caupNP_524046.2 Homeobox_KN 245..283 CDD:428673 18/37 (49%)
IRO 455..472 CDD:214716
Tgif2lx2NP_001136222.1 Homeobox_KN 59..94 CDD:428673 16/34 (47%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.