powered by:
Protein Alignment ara and TGIF2LY
DIOPT Version :9
Sequence 1: | NP_524045.2 |
Gene: | ara / 39439 |
FlyBaseID: | FBgn0015904 |
Length: | 717 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_631960.1 |
Gene: | TGIF2LY / 90655 |
HGNCID: | 18569 |
Length: | 185 |
Species: | Homo sapiens |
Alignment Length: | 56 |
Identity: | 23/56 - (41%) |
Similarity: | 36/56 - (64%) |
Gaps: | 0/56 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 258 RRKNATRESTATLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRL 313
|:.|...||...|:.|:.:|:...||::.||.||:..|.::|.::|.||.|||||:
Human 53 RKGNLPAESVKILRDWMYKHRFKAYPSEEEKQMLSEKTNLSLLRISNWFINARRRI 108
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.