DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ara and TGIF2LX

DIOPT Version :10

Sequence 1:NP_524045.2 Gene:ara / 39439 FlyBaseID:FBgn0015904 Length:717 Species:Drosophila melanogaster
Sequence 2:NP_620410.3 Gene:TGIF2LX / 90316 HGNCID:18570 Length:241 Species:Homo sapiens


Alignment Length:56 Identity:24/56 - (42%)
Similarity:36/56 - (64%) Gaps:0/56 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   258 RRKNATRESTATLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRL 313
            |:.|...||...|:.|:.:|:...||::.||.||:..|.::|.|:|.||.|||||:
Human    53 RKGNLPAESVKILRDWMYKHRFKAYPSEEEKQMLSEKTNLSLLQISNWFINARRRI 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
araNP_524045.2 COG5576 <237..>318 CDD:227863 24/56 (43%)
Homeobox_KN 274..312 CDD:428673 16/37 (43%)
TGIF2LXNP_620410.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..58 2/4 (50%)
Homeobox_KN 69..107 CDD:428673 16/37 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 126..210
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.