DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ara and TOS8

DIOPT Version :9

Sequence 1:NP_524045.2 Gene:ara / 39439 FlyBaseID:FBgn0015904 Length:717 Species:Drosophila melanogaster
Sequence 2:NP_011419.1 Gene:TOS8 / 852783 SGDID:S000003064 Length:276 Species:Saccharomyces cerevisiae


Alignment Length:195 Identity:56/195 - (28%)
Similarity:84/195 - (43%) Gaps:38/195 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 ENGRPIMTDPVSGQTVCSCQYDSARLALSSYSRLPAASVGVYGTPYPSTDQNPYQSIGVDSSAFY 198
            :|...|||..:....|.   |::.|..:|:..|....:||  |.|..|: |..|:.|...:  ||
Yeast    79 QNHNAIMTQNIRQYPVI---YNNNREVISTGERNYIITVG--GPPVTSS-QPEYEHISTPN--FY 135

  Fly   199 SP--LSNPYGLKDTGAGPEMGAWTSAGLQPTTGYYSYDPMSAYGGLLV-----------SNSSYG 250
            ..  |:.|:.:.::              ....||.:..|:|...|.::           ||:.|.
Yeast   136 QEQRLAQPHPVNES--------------MMIGGYTNPQPISISRGKMLSGNISTNSVRGSNNGYS 186

  Fly   251 A---SYDLAARRKNATRESTATLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRR 312
            |   .:....:|.|..:.:.:.|..||:||..|||||..||..|...|.:|..|:|.||.|||||
Yeast   187 AKEKKHKAHGKRSNLPKATVSILNKWLHEHVNNPYPTVQEKRELLAKTGLTKLQISNWFINARRR 251

  Fly   313  312
            Yeast   252  251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
araNP_524045.2 Homeobox_KN 273..312 CDD:283551 21/38 (55%)
TOS8NP_011419.1 Homeobox_KN 212..251 CDD:399131 21/38 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.