DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ara and KNAT4

DIOPT Version :10

Sequence 1:NP_524045.2 Gene:ara / 39439 FlyBaseID:FBgn0015904 Length:717 Species:Drosophila melanogaster
Sequence 2:NP_196667.2 Gene:KNAT4 / 830973 AraportID:AT5G11060 Length:393 Species:Arabidopsis thaliana


Alignment Length:58 Identity:22/58 - (37%)
Similarity:35/58 - (60%) Gaps:3/58 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   258 RRKNATR---ESTATLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRR 312
            |::.|.:   ::|:.||:|...|.|.||||:.:|..|...|.:.|.|::.||.|.|:|
plant   308 RKRRAGKLPGDTTSVLKSWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
araNP_524045.2 COG5576 <237..>318 CDD:227863 22/58 (38%)
Homeobox_KN 274..312 CDD:428673 15/37 (41%)
KNAT4NP_196667.2 KNOX1 124..161 CDD:461051
KNOX2 182..231 CDD:427506
ELK 286..307 CDD:427504
Homeobox_KN 327..365 CDD:428673 15/37 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.