DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ara and ATH1

DIOPT Version :10

Sequence 1:NP_524045.2 Gene:ara / 39439 FlyBaseID:FBgn0015904 Length:717 Species:Drosophila melanogaster
Sequence 2:NP_195024.1 Gene:ATH1 / 829435 AraportID:AT4G32980 Length:473 Species:Arabidopsis thaliana


Alignment Length:75 Identity:27/75 - (36%)
Similarity:40/75 - (53%) Gaps:16/75 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   258 RRKN---------ATRESTATLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRL 313
            :|||         ...:|.:.|:.|:.::..:|||...||.:|||.:.:|.:|||.||.|||.||
plant   366 KRKNHQIWRPQRGLPEKSVSVLRNWMFQNFLHPYPKDSEKHLLAIRSGLTRSQVSNWFINARVRL 430

  Fly   314 KKENKMTWEP 323
                   |:|
plant   431 -------WKP 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
araNP_524045.2 COG5576 <237..>318 CDD:227863 25/68 (37%)
Homeobox_KN 274..312 CDD:428673 17/37 (46%)
ATH1NP_195024.1 POX 196..334 CDD:214728
Homeobox_KN 391..429 CDD:428673 17/37 (46%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.