DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ara and KNAT5

DIOPT Version :10

Sequence 1:NP_524045.2 Gene:ara / 39439 FlyBaseID:FBgn0015904 Length:717 Species:Drosophila melanogaster
Sequence 2:NP_194932.1 Gene:KNAT5 / 829335 AraportID:AT4G32040 Length:383 Species:Arabidopsis thaliana


Alignment Length:66 Identity:24/66 - (36%)
Similarity:36/66 - (54%) Gaps:3/66 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   258 RRKNATR---ESTATLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKM 319
            |::.|.:   ::|:.||.|...|.|.||||:.:|..|...|.:.|.|::.||.|.|:|....|..
plant   303 RKRRAGKLPGDTTSVLKEWWRTHSKWPYPTEEDKAKLVQETGLQLKQINNWFINQRKRNWNSNSS 367

  Fly   320 T 320
            |
plant   368 T 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
araNP_524045.2 COG5576 <237..>318 CDD:227863 22/62 (35%)
Homeobox_KN 274..312 CDD:428673 15/37 (41%)
KNAT5NP_194932.1 KNOX1 117..156 CDD:461051
KNOX2 170..221 CDD:427506
ELK 281..302 CDD:427504
Homeobox_KN 322..360 CDD:428673 15/37 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.