DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ara and Meis1

DIOPT Version :9

Sequence 1:NP_524045.2 Gene:ara / 39439 FlyBaseID:FBgn0015904 Length:717 Species:Drosophila melanogaster
Sequence 2:XP_006251591.1 Gene:Meis1 / 686117 RGDID:1585482 Length:465 Species:Rattus norvegicus


Alignment Length:273 Identity:69/273 - (25%)
Similarity:103/273 - (37%) Gaps:63/273 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 GPEMGAWTSAGLQPTTGYYSYDPMSAYGGLL---VSNSSYGASYDLAARRKNATRE------STA 268
            ||..|..||         :|.|..|..|..|   |::.|.|...|....:|...:.      :|.
  Rat   230 GPSSGGHTS---------HSGDNSSEQGDGLDNSVASPSTGDDDDPDKDKKRHKKRGIFPKVATN 285

  Fly   269 TLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWEPKNRTDDDDDA 333
            .::|||.:|..:|||::.:|..||..|.:|:.||:.||.|||||:.:.          ..|..:.
  Rat   286 IMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQP----------MIDQSNR 340

  Fly   334 LVSDDEKDKEDLEPSKGSQGSVSLAKDETKEEEDAIDEDQKCLGQANILRAGFGYPSAGSGSGGY 398
            .||.......|.:|..|                 .:.:.|:.:|    :||    |...|..|.|
  Rat   341 AVSQGTPYNPDGQPMGG-----------------FVMDGQQHMG----IRA----PGLQSMPGEY 380

  Fly   399 PGGGGS---SSGHPGGYHPYHHQHPAYYQAG-QQGGMLPFHGENSKLQTDLGDPKNQLGRDCGVP 459
            ...||.   |.|.|.........|||..:.| .....:|.|..:..:....|.|..      |:|
  Rat   381 VARGGPMGVSMGQPSYTQAQMPPHPAQLRHGPPMHTYIPGHPHHPAVMMHGGQPHP------GMP 439

  Fly   460 IPATKPKIWSLAD 472
            :.|:.|.:.:..|
  Rat   440 MSASSPSVLNTGD 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
araNP_524045.2 Homeobox_KN 273..312 CDD:283551 18/38 (47%)
Meis1XP_006251591.1 Meis_PKNOX_N 108..192 CDD:406806
Homeobox_KN 290..329 CDD:399131 18/38 (47%)
PABP-1234 <326..449 CDD:130689 35/163 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.