DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ara and Irx5

DIOPT Version :9

Sequence 1:NP_524045.2 Gene:ara / 39439 FlyBaseID:FBgn0015904 Length:717 Species:Drosophila melanogaster
Sequence 2:NP_001025215.1 Gene:Irx5 / 498918 RGDID:1565518 Length:484 Species:Rattus norvegicus


Alignment Length:460 Identity:154/460 - (33%)
Similarity:198/460 - (43%) Gaps:132/460 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 YSRLPAASVGVYGTPY--------PSTDQ----------NPYQSIGVDSSAFYSPLSNPYGLKDT 210
            |...|:||:.:|..|.        |.||:          :||    ..|:||.:|..........
  Rat     7 YLYQPSASLALYSCPAYSTSVISGPRTDELGRSSSGSAFSPY----AGSTAFTAPSPGYNSHLQY 67

  Fly   211 GAGPEMGAWT-----------SAGLQPTTGYYSY-DPMSAYGGLLVSNSSYGASYDLAARRKNAT 263
            ||.|...|..           :.|:..:.||:.| .|:.:|            .|...|.|||||
  Rat    68 GADPAAAAAAAFSYVGSPYDHTPGMAGSLGYHPYAAPLGSY------------PYGDPAYRKNAT 120

  Fly   264 RESTATLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWEPKNRTD 328
            |::|||||||||||:||||||||||||||||||||||||||||.||||||||||||||.|:||::
  Rat   121 RDATATLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFVNARRRLKKENKMTWTPRNRSE 185

  Fly   329 DDDDA----LVSDDE------KDKEDLE-PSKGS------------QGSVSLAKDETKEEEDAID 370
            |:::.    |..:||      :||.||| |..|.            ||.:|.|..||  |....|
  Rat   186 DEEEEENIDLEKNDEDEPQKPEDKGDLEGPEAGGTEQKAAAGCERLQGPLSPAGKET--EGSLSD 248

  Fly   371 EDQK---CLGQANIL----RAGFGYPS-------AGSGSGGYPGGGGSSSGHPGGYHPYHHQHPA 421
            .|.|   ..|:.:.|    |||...|:       |......||.|..:...||..          
  Rat   249 SDFKESPSEGRHDDLPRPPRAGEPSPAGPATARLAEDAGPHYPAGAPAPGPHPSA---------- 303

  Fly   422 YYQAGQQGGMLPFHGENSKLQTDLGDPKNQLGRDCGVPIPA--TKPKIWSLAD------------ 472
                   |.:.|..|.:|.:.:....|.         |.||  .|||:||||:            
  Rat   304 -------GELPPGSGGSSVIHSPPPPPP---------PPPAVLAKPKLWSLAEIATSSDKVKDGG 352

  Fly   473 --TVGCKTPP-PAYMGHQSMPLQQQQQQQQQQQQAQHQYP-PSEAGRDQQLFNGAAAPYLRPHTT 533
              :.|...|| |..:|.|::...:........:....|.| |......:.|:  ..||:. |..|
  Rat   353 GGSEGSPCPPCPGPIGGQTLGGSRASPAPAPARSPSAQCPFPGGTVLSRPLY--YTAPFY-PGYT 414

  Fly   534 AYGGF 538
            .||.|
  Rat   415 NYGSF 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
araNP_524045.2 Homeobox_KN 273..312 CDD:283551 36/38 (95%)
Irx5NP_001025215.1 Homeobox_KN 130..169 CDD:283551 36/38 (95%)
IRO 328..345 CDD:214716 8/16 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 86 1.000 Domainoid score I7886
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11211
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.870

Return to query results.
Submit another query.