Sequence 1: | NP_524045.2 | Gene: | ara / 39439 | FlyBaseID: | FBgn0015904 | Length: | 717 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_002389.1 | Gene: | MEIS1 / 4211 | HGNCID: | 7000 | Length: | 390 | Species: | Homo sapiens |
Alignment Length: | 225 | Identity: | 53/225 - (23%) |
---|---|---|---|
Similarity: | 78/225 - (34%) | Gaps: | 90/225 - (40%) |
- Green bases have known domain annotations that are detailed below.
Fly 213 GPEMGAWTSAGLQPTTGYYSYDPMSAYGGLL---VSNSSYGASYDLAARRKNATRE------STA 268
Fly 269 TLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWEPKNRTDDDDDA 333
Fly 334 LVSDDEKDKEDLEPSKGSQGSVSLAKDETKEEEDAIDEDQKCLGQANILRAGFGYPSAGSGSGGY 398
Fly 399 ------------PG---GGGSSSGHPGGYH 413 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ara | NP_524045.2 | Homeobox_KN | 273..312 | CDD:283551 | 18/38 (47%) |
MEIS1 | NP_002389.1 | Meis_PKNOX_N | 108..192 | CDD:406806 | |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 190..279 | 15/57 (26%) | |||
Homeobox_KN | 290..329 | CDD:399131 | 18/38 (47%) | ||
Interaction with DNA. /evidence=ECO:0000305|PubMed:26550823, ECO:0000305|PubMed:28473536 | 299..329 | 14/29 (48%) | |||
Required for transcriptional activation. /evidence=ECO:0000250 | 335..390 | 15/60 (25%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0773 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |