DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ara and Meis3

DIOPT Version :9

Sequence 1:NP_524045.2 Gene:ara / 39439 FlyBaseID:FBgn0015904 Length:717 Species:Drosophila melanogaster
Sequence 2:XP_038937577.1 Gene:Meis3 / 361514 RGDID:1308532 Length:443 Species:Rattus norvegicus


Alignment Length:239 Identity:68/239 - (28%)
Similarity:91/239 - (38%) Gaps:79/239 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 TTPTAGGAGGGGS--------------------CCENGRPIMTDPVSGQTVCSCQYDSARLALSS 163
            :||.....||..|                    |.:...||  |.|.......|:.|....|.|.
  Rat   185 STPALAPPGGPPSTPLPSQVHDLCDNFCHRYITCLKGKMPI--DLVIEDRDGGCREDLEDYAASC 247

  Fly   164 YSRLP------------AASVGVYGTPYPSTDQNPYQSIGVDSSAFYSPLSNPYGLKDTGAGPEM 216
            .| ||            :.||.: |||.||:.....|| |.:||.                    
  Rat   248 PS-LPDQNTTWIRDHEDSGSVHL-GTPGPSSGGLASQS-GDNSSD-------------------- 289

  Fly   217 GAWTSA---GLQPTTGYYSYDPMSAYGGL---LVSNSSYGASYDL-AARRKNATR-----ESTAT 269
            ..|..|   |:.|:.|          .||   :.|.||.|...|| ..||:|..|     .:|..
  Rat   290 QVWCLAVQWGMCPSPG----------DGLDTSVASPSSAGEDEDLDLERRRNKKRGIFPKVATNI 344

  Fly   270 LKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRL 313
            ::|||.:|..:|||::.:|..||..|.:|:.||:.||.|||||:
  Rat   345 MRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRI 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
araNP_524045.2 Homeobox_KN 273..312 CDD:283551 18/38 (47%)
Meis3XP_038937577.1 Meis_PKNOX_N 99..234 CDD:406806 10/50 (20%)
Homeobox_KN 348..387 CDD:399131 18/38 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.