DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ara and Tgif1

DIOPT Version :9

Sequence 1:NP_524045.2 Gene:ara / 39439 FlyBaseID:FBgn0015904 Length:717 Species:Drosophila melanogaster
Sequence 2:NP_001015020.1 Gene:Tgif1 / 316742 RGDID:1310517 Length:287 Species:Rattus norvegicus


Alignment Length:134 Identity:45/134 - (33%)
Similarity:65/134 - (48%) Gaps:18/134 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 GAGPEMGAWTS--AGLQPTTGYYSYDPMSAYGGLLVSNSSYGASYDLAARRKNATRESTATLKAW 273
            |:|     |.|  ..:...:|..|.|..|....|.:|:|   |:.....||.|..:||...|:.|
  Rat    12 GSG-----WPSRHGVVAAASGSDSEDEDSMDSPLDLSSS---AASGKRRRRGNLPKESVQILRDW 68

  Fly   274 LNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRR-----LKKENKMTWEPKNRTDDDDDA 333
            |.||:.|.||::.||.:|:..|.::..||..||.|||||     |:|:.|   :|...|.....|
  Rat    69 LYEHRYNAYPSEQEKALLSQQTHLSTLQVCNWFINARRRLLPDMLRKDGK---DPNQFTISRRGA 130

  Fly   334 LVSD 337
            .:|:
  Rat   131 KISE 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
araNP_524045.2 Homeobox_KN 273..312 CDD:283551 18/38 (47%)
Tgif1NP_001015020.1 Homeobox_KN 68..107 CDD:283551 18/38 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.