DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ara and MKX

DIOPT Version :9

Sequence 1:NP_524045.2 Gene:ara / 39439 FlyBaseID:FBgn0015904 Length:717 Species:Drosophila melanogaster
Sequence 2:NP_001229631.1 Gene:MKX / 283078 HGNCID:23729 Length:352 Species:Homo sapiens


Alignment Length:191 Identity:58/191 - (30%)
Similarity:86/191 - (45%) Gaps:29/191 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 KDTGAGPEMGAWTSAGLQPTTGYYSYDPMSAYGGLLVSNSSYGASYDLAARRKNATRESTATLKA 272
            ::.|..|..|...|...:|..|.....|:....||....:....:......::.|.::....||.
Human    23 RERGGRPYSGVLDSPHARPEVGIPDGPPLKDNLGLRHRRTGARQNGGKVRHKRQALQDMARPLKQ 87

  Fly   273 WLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLK---KENKMTWE------PKNRTD 328
            ||.:|:.||||||.|||:||:.::|||.|||.||||||||||   ::..::|.      .|....
Human    88 WLYKHRDNPYPTKTEKILLALGSQMTLVQVSNWFANARRRLKNTVRQPDLSWALRIKLYNKYVQG 152

  Fly   329 DDDDALVSDDEKDKEDLE------------------PSKGSQGSVSLA--KDETKEEEDAI 369
            :.:...||.|:...||.|                  |...|:.||..|  :.|::..||.:
Human   153 NAERLSVSSDDSCSEDGENPPRTHMNEGGYNTPVHHPVIKSENSVIKAGVRPESRASEDYV 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
araNP_524045.2 Homeobox_KN 273..312 CDD:283551 26/38 (68%)
MKXNP_001229631.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 19..54 7/30 (23%)
Homeobox_KN 88..127 CDD:399131 26/38 (68%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 159..189 6/29 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 245..301
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.