DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ara and Meis3

DIOPT Version :9

Sequence 1:NP_524045.2 Gene:ara / 39439 FlyBaseID:FBgn0015904 Length:717 Species:Drosophila melanogaster
Sequence 2:XP_036008636.1 Gene:Meis3 / 17537 MGIID:108519 Length:400 Species:Mus musculus


Alignment Length:191 Identity:62/191 - (32%)
Similarity:84/191 - (43%) Gaps:41/191 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 SCCENGRPIMTDPVSGQTVCSCQYDSARLALSSYSRLPAASVGVYGTPYPS-TDQN-PYQSIGVD 193
            :|.:...||  |.|......||:.|     |..|    |||.       || .||| .:.....|
Mouse   188 TCLKGKMPI--DLVIEDRDGSCRED-----LEDY----AASC-------PSLPDQNTTWIRDHED 234

  Fly   194 SSAFYSPLSNPYGLKDTGAGPEMGAWTSAGLQPTTGYYSYDPMSAYGGLLVSNSSYGASYDL-AA 257
            |.:.:  |..|        ||     :|.||...:|..|.|........:.|.||.|...|| ..
Mouse   235 SGSVH--LGTP--------GP-----SSGGLASQSGDNSSDQGDGLDTSVASPSSAGEDEDLDLE 284

  Fly   258 RRKNATR-----ESTATLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRL 313
            ||:|..|     .:|..::|||.:|..:|||::.:|..||..|.:|:.||:.||.|||||:
Mouse   285 RRRNKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRI 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
araNP_524045.2 Homeobox_KN 273..312 CDD:283551 18/38 (47%)
Meis3XP_036008636.1 Meis_PKNOX_N 99..205 CDD:406806 5/18 (28%)
Homeobox_KN 305..344 CDD:399131 18/38 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.