DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ara and meis1a

DIOPT Version :9

Sequence 1:NP_524045.2 Gene:ara / 39439 FlyBaseID:FBgn0015904 Length:717 Species:Drosophila melanogaster
Sequence 2:NP_571972.2 Gene:meis1a / 170455 ZFINID:ZDB-GENE-020122-3 Length:380 Species:Danio rerio


Alignment Length:125 Identity:38/125 - (30%)
Similarity:58/125 - (46%) Gaps:21/125 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 TGAGPEMGAW------------TSAGLQPTTGYYSYDPMSAYGGLL---VSNSSYGASYDLAARR 259
            |..|.|...|            |.|.....:..::.|..|.:|..|   |::.|.|...|....|
Zfish   195 TPGGSEQVFWREDDTASVHSTDTPAACGRRSSSHNGDNSSEHGDFLDQSVASPSTGEEEDPDKER 259

  Fly   260 KNATRE------STATLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRL 313
            ||..:.      :|..::|||.:|..:|||::.:|..|:..|.:|:.||:.||.|||||:
Zfish   260 KNNKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKRQLSQDTGLTILQVNNWFINARRRI 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
araNP_524045.2 Homeobox_KN 273..312 CDD:283551 17/38 (45%)
meis1aNP_571972.2 Meis_PKNOX_N 99..182 CDD:293102
Homeobox_KN 279..318 CDD:283551 17/38 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.