DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ara and meis2a

DIOPT Version :9

Sequence 1:NP_524045.2 Gene:ara / 39439 FlyBaseID:FBgn0015904 Length:717 Species:Drosophila melanogaster
Sequence 2:XP_009291615.1 Gene:meis2a / 170454 ZFINID:ZDB-GENE-020122-2 Length:409 Species:Danio rerio


Alignment Length:336 Identity:75/336 - (22%)
Similarity:105/336 - (31%) Gaps:147/336 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 SCCENGRPIMTDPVSGQTVCSCQYDSARLALSSYS-------------RL----------PAASV 172
            ||.:...||  |.|..:...|.:.|...|:.||.:             ||          .|.|.
Zfish   173 SCLKGKMPI--DLVIDERDGSSKSDHEELSGSSTNLADHMGNGWIRSDRLQNPASWRDHDDATST 235

  Fly   173 GVYGTPYPST--------DQNPYQSIGVDSSAFYSPLSNPYGLKDTGAGPEMGAWTSAGLQPTTG 229
            ...|||.||:        |.:..|..|:|:|     :::|      |.|.:              
Zfish   236 HSAGTPGPSSGGLASQSGDNSSEQGDGLDNS-----VASP------GTGDD-------------- 275

  Fly   230 YYSYDPMSAYGGLLVSNSSYGASYDLAARRKNATRESTAT--LKAWLNEHKKNPYPTKGEKIMLA 292
               .||                ..|...::|.......||  ::|||.:|..:|||::.:|..||
Zfish   276 ---DDP----------------DKDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLA 321

  Fly   293 IITKMTLTQVSTWFANARRRLKKENKMTWEPKNRTDDDDDALVSDDEKDKEDLEPSKGSQGSVSL 357
            ..|.:|:.||:.||.|||||:.                                           
Zfish   322 QDTGLTILQVNNWFINARRRIV------------------------------------------- 343

  Fly   358 AKDETKEEEDAIDEDQKCLGQANILRAGFGY-PSAGSGSGGYPGGGGSSSGHP-GGYHPYHHQHP 420
                           |..:.|:|  ||||.. ||...|:...|      .|.| |.:.....||.
Zfish   344 ---------------QPMIDQSN--RAGFLLDPSVSQGAAYSP------EGQPMGSFVLDGQQHM 385

  Fly   421 AYYQAGQQGGM 431
            ....||...||
Zfish   386 GIRPAGPMSGM 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
araNP_524045.2 Homeobox_KN 273..312 CDD:283551 18/38 (47%)
meis2aXP_009291615.1 Meis_PKNOX_N 106..189 CDD:293102 6/17 (35%)
Homeobox_KN 302..341 CDD:283551 18/38 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.