powered by:
Protein Alignment ara and TGIF2-RAB5IF
DIOPT Version :9
Sequence 1: | NP_524045.2 |
Gene: | ara / 39439 |
FlyBaseID: | FBgn0015904 |
Length: | 717 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001186464.1 |
Gene: | TGIF2-RAB5IF / 100527943 |
HGNCID: | 44664 |
Length: | 155 |
Species: | Homo sapiens |
Alignment Length: | 74 |
Identity: | 25/74 - (33%) |
Similarity: | 38/74 - (51%) |
Gaps: | 11/74 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 244 VSNSSYGAS---YDLAARRK---NATRESTATLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQ- 301
:|:|..|.. ..||.:|| |..:||...|:.||..|:.|.||::.||:.|:..|.:::.|
Human 1 MSDSDLGEDEGLLSLAGKRKRRGNLPKESVKILRDWLYLHRYNAYPSEQEKLSLSGQTNLSVLQD 65
Fly 302 ----VSTWF 306
|..||
Human 66 EFLDVIYWF 74
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG0773 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.