DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ara and meis1

DIOPT Version :9

Sequence 1:NP_524045.2 Gene:ara / 39439 FlyBaseID:FBgn0015904 Length:717 Species:Drosophila melanogaster
Sequence 2:XP_002931792.1 Gene:meis1 / 100488182 XenbaseID:XB-GENE-479439 Length:465 Species:Xenopus tropicalis


Alignment Length:339 Identity:84/339 - (24%)
Similarity:115/339 - (33%) Gaps:118/339 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 PSTDQNPYQSIGVDSSAFYSPLSNPYGLKDTGAGPEMGAWTSAGLQPTTGYYSYDPMSAYGGLL- 243
            |.||| |..|...|.:|.......|        ||..|..||         :|.|..|..|..| 
 Frog   206 PLTDQ-PSWSRDHDDTASTRSGGTP--------GPSSGGHTS---------HSGDNSSEQGDGLD 252

  Fly   244 --VSNSSYGASYDLAARRKNATRE------STATLKAWLNEHKKNPYPTKGEKIMLAIITKMTLT 300
              |::.|.|...|....:|...:.      :|..::|||.:|..:|||::.:|..||..|.:|:.
 Frog   253 NSVASPSTGDDDDPDKDKKRHKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTIL 317

  Fly   301 QVSTWFANARRRLKKENKMTWEPKNRTDDDDDALVSDDEKDKEDLEPSKGSQGSVSLAKDETKEE 365
            ||:.||.|||||:.:.          ..|..:..||.......|.:|..|               
 Frog   318 QVNNWFINARRRIVQP----------MIDQSNRAVSQGTPYNADGQPMGG--------------- 357

  Fly   366 EDAIDEDQKCLGQANILRAGFGYPSAGSGSGGY--PGGG-GSSSGHPG----------------- 410
              .:.:.|:.:|    :||    |......|.|  |.|. |.|.|.|.                 
 Frog   358 --FVMDGQQHMG----IRA----PGLQGMPGSYISPSGPMGMSMGQPSYTTSQMPLHHAQLRHGT 412

  Fly   411 ---GYHPYHHQHPAYYQAGQQGGMLPFHGENSKLQTDLGDPKNQLGRDCGVPIPATKPKIWSLAD 472
               .|.|.||.|||          :..||         |.|..      |:||..:.|.:.:..|
 Frog   413 SVHTYIPGHHHHPA----------MMMHG---------GPPHP------GMPISTSSPSVLNTGD 452

  Fly   473 TVGCKTPPPAYMGH 486
                    |...||
 Frog   453 --------PTMGGH 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
araNP_524045.2 Homeobox_KN 273..312 CDD:283551 18/38 (47%)
meis1XP_002931792.1 Meis_PKNOX_N 108..192 CDD:374576
Homeobox_KN 290..329 CDD:368670 18/38 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.