DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sowah and YAR1

DIOPT Version :9

Sequence 1:NP_001137943.2 Gene:sowah / 39438 FlyBaseID:FBgn0036302 Length:780 Species:Drosophila melanogaster
Sequence 2:NP_015085.1 Gene:YAR1 / 855837 SGDID:S000006160 Length:200 Species:Saccharomyces cerevisiae


Alignment Length:105 Identity:34/105 - (32%)
Similarity:52/105 - (49%) Gaps:25/105 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   268 EKDSPEVTLA----HPKAKEWIV-SMAKAN-YQELAKMASEYPELVKLQCPATGYTALHWAAKHG 326
            |.||..:.:|    |.:...:|: ::::|| .::|....:|..:        ||.||||||:.:|
Yeast    48 ESDSTALHMAAANGHIETVRYILETVSRANSAEDLKAFVNEVNK--------TGNTALHWASLNG 104

  Fly   327 NEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFE 366
            ..|||||:...|:||...|           .:||.|.|||
Yeast   105 KLDVVKLLCDEYEADPFIR-----------NKFGHDAIFE 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sowahNP_001137943.2 Ank_4 289..333 CDD:290365 16/44 (36%)
ANK <315..393 CDD:238125 23/52 (44%)
Ank_4 315..368 CDD:290365 23/52 (44%)
ANK repeat 315..346 CDD:293786 16/30 (53%)
ANK repeat 348..380 CDD:293786 6/19 (32%)
YAR1NP_015085.1 ANK repeat 11..47 CDD:293786
Ank_2 20..124 CDD:403870 28/94 (30%)
ANK repeat 49..90 CDD:293786 9/40 (23%)
ANK repeat 92..124 CDD:293786 18/42 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2336
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.