DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sowah and sowahcb

DIOPT Version :9

Sequence 1:NP_001137943.2 Gene:sowah / 39438 FlyBaseID:FBgn0036302 Length:780 Species:Drosophila melanogaster
Sequence 2:XP_009298061.1 Gene:sowahcb / 563244 ZFINID:ZDB-GENE-061215-96 Length:462 Species:Danio rerio


Alignment Length:463 Identity:106/463 - (22%)
Similarity:166/463 - (35%) Gaps:148/463 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LANEC--------------KVTNHALVKHFKKFL-THPQSQNEARKRFKTYVTLLSTIKNENNQK 66
            :|.||              :|.|..|..:|:..: ..|..:.|||:.||.:|..::.:|.||.:|
Zfish    25 MATECSQHAVLRFIEERGGRVKNGDLADYFRAAIPQEPALKQEAREAFKRHVDTVAYVKEENGEK 89

  Fly    67 FLILRKKYVNECPTDEVVERAVAAASGIPEPSSPGGASLNFDSPMRQPPPYKPPPMVTSPPA--- 128
            ::.|||::.. |                  |.|.||...:.|.|              :|.|   
Zfish    90 YVCLRKRFWG-C------------------PRSAGGERADTDDP--------------APAARAR 121

  Fly   129 ----------VSIAKEHQENYQECVDEFTAAIKRIEPARLERRTSVKSEDLDQQ--EKPEKTSRS 181
                      ...|:.|....:|.|:..|.|..|   |.:|...|.:|.:...:  |:||:    
Zfish   122 TLSSGYGTADAGGAETHPHISEEGVNGGTPAELR---AHMENSDSNRSAEQRPKAAEQPEE---- 179

  Fly   182 NSIDVIDNKENIPRFSFSSEASSASSTSIEKPEMADPTAPAAVG--------DVAENPISVKEAT 238
                                  .|::|..|  |...|.:|..||        |..|:|...:|..
Zfish   180 ----------------------RAAATGGE--ERDGPESPGWVGSSPAEQQRDSGESPGRCRECP 220

  Fly   239 RKFNRMASEEEAKIISPPAKKKPEKQLIEEKDSPEVTLAHPKAKEWIVSMAKANYQELAKMASEY 303
                |..|:.||                     ..||| .|....|::|.:..:::.|..:....
Zfish   221 ----RADSDYEA---------------------AAVTL-EPLEHAWMMSASDGHWESLRPLLDTE 259

  Fly   304 PELVKLQCPATGYTALHWAAKHGNEDVVKLIA-----GTYKADVNARTNGGYTPLHLATQFGRDN 363
            |.||..:...||:|.||||||.|..:::.|:.     .....:||||::.||||||||.......
Zfish   260 PALVARKDFVTGFTCLHWAAKLGKHELIVLLVRFAREHRVSVNVNARSSAGYTPLHLAAIHNHLE 324

  Fly   364 IFELLWNVYKANRDIMDWSGNKPLDYSR---------------QRSSVSASTCSSEYAKYFFGAD 413
            :.:||.....|:.:..|:.|.|...|.:               :.....|.....|..::.....
Zfish   325 VVKLLVGALDADVEARDYYGRKACQYLKSDVAQNILEIAGACAEAEGACAGEAEGEAGRWRLSRV 389

  Fly   414 VGNSFRTL 421
            :.:|||.|
Zfish   390 LQSSFRPL 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sowahNP_001137943.2 Ank_4 289..333 CDD:290365 14/43 (33%)
ANK <315..393 CDD:238125 29/97 (30%)
Ank_4 315..368 CDD:290365 22/57 (39%)
ANK repeat 315..346 CDD:293786 13/35 (37%)
ANK repeat 348..380 CDD:293786 11/31 (35%)
sowahcbXP_009298061.1 PHA03169 13..>214 CDD:223003 54/252 (21%)
Ank_2 241..341 CDD:289560 31/99 (31%)
ANK 270..>361 CDD:238125 30/90 (33%)
ANK repeat 271..307 CDD:293786 13/35 (37%)
ANK repeat 309..341 CDD:293786 11/31 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 127 1.000 Inparanoid score I4660
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1531345at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24452
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3353
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.