DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sowah and pyx

DIOPT Version :9

Sequence 1:NP_001137943.2 Gene:sowah / 39438 FlyBaseID:FBgn0036302 Length:780 Species:Drosophila melanogaster
Sequence 2:NP_612015.1 Gene:pyx / 38037 FlyBaseID:FBgn0035113 Length:956 Species:Drosophila melanogaster


Alignment Length:192 Identity:49/192 - (25%)
Similarity:81/192 - (42%) Gaps:30/192 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   268 EKDSPEVTLAHPKAKEWIVSMAKANYQELAKMASEYPELVKLQCPATGYTALHWAAKHGNEDVVK 332
            :.::|:|....|     :.:.:.|.:.:..::...:...|:.|......||||.||::...:..:
  Fly   224 DPNTPQVYTETP-----LHTASAAGFAKCVQLLLSHNADVRSQFGEGKVTALHLAAENDYVECAR 283

  Fly   333 LIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLWNVYKANRDIMDWSGNKPLDYSRQRSSVS 397
            |:. .::|:|:.|.....||||||.........:||.: |.||.:.:...|...|..:..:.|.|
  Fly   284 LLL-EHRAEVDCRNASHQTPLHLACLSQSIGTVDLLIS-YGANVNAVYRDGRTALHAAIVKQSRS 346

  Fly   398 ASTCSSEYAKYFFGADVG---------------NSFRT--LGFIE-SSQITGGTLG--SALT 439
            ...|:   |....||||.               |.|.:  ..||| .:.||..|.|  |||:
  Fly   347 LDCCN---ALLKAGADVNKADNYGYTPLHIAALNEFSSCVYTFIEHGADITARTDGRVSALS 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sowahNP_001137943.2 Ank_4 289..333 CDD:290365 9/43 (21%)
ANK <315..393 CDD:238125 23/77 (30%)
Ank_4 315..368 CDD:290365 16/52 (31%)
ANK repeat 315..346 CDD:293786 9/30 (30%)
ANK repeat 348..380 CDD:293786 11/31 (35%)
pyxNP_612015.1 Ank_4 99..153 CDD:290365
ANK repeat 102..130 CDD:293786
ANK 127..252 CDD:238125 4/32 (13%)
ANK repeat 132..163 CDD:293786
Ank_2 137..226 CDD:289560 0/1 (0%)
ANK repeat 166..196 CDD:293786
ANK 198..319 CDD:238125 23/100 (23%)
ANK repeat 200..229 CDD:293786 0/4 (0%)
Ank_2 203..296 CDD:289560 15/77 (19%)
ANK repeat 231..262 CDD:293786 3/35 (9%)
ANK 268..387 CDD:238125 33/123 (27%)
ANK repeat 268..296 CDD:293786 9/28 (32%)
Ank_2 270..364 CDD:289560 29/98 (30%)
ANK repeat 298..329 CDD:293786 11/31 (35%)
ANK repeat 331..364 CDD:293786 10/35 (29%)
Ank_5 353..404 CDD:290568 14/50 (28%)
ANK repeat 366..396 CDD:293786 7/29 (24%)
Ion_trans 556..734 CDD:278921
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2336
SonicParanoid 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.