DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sowah and ANK2

DIOPT Version :9

Sequence 1:NP_001137943.2 Gene:sowah / 39438 FlyBaseID:FBgn0036302 Length:780 Species:Drosophila melanogaster
Sequence 2:NP_001373103.1 Gene:ANK2 / 287 HGNCID:493 Length:4183 Species:Homo sapiens


Alignment Length:944 Identity:171/944 - (18%)
Similarity:290/944 - (30%) Gaps:324/944 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 DEVVERAVAAASGIPEPSSPGGASLNFDSPMRQPPPYKPPPMVTS----PPAVSIAKEHQENYQE 141
            |:.:|:.....|....|.||       |:|..:...|:..|..|.    .|||         ..|
Human  2566 DDSLEQTSLMESSGKSPLSP-------DTPSSEEVSYEVTPKTTDVSTPKPAV---------IHE 2614

  Fly   142 CVDE----------FT---------AAIKRIEPARLERRTSVKSEDLDQQEKPEKTSRSN----- 182
            |.:|          ||         ..||..:  .||:....| .|..::.|.|::|.|:     
Human  2615 CAEEDDSENGEKKRFTPEEEMFKMVTKIKMFD--ELEQEAKQK-RDYKKEPKQEESSSSSDPDAD 2676

  Fly   183 -SIDVIDNK--------ENIPRFSFSSEASSASSTSIEKPEMA------------------DPTA 220
             |:||.:.|        ..:| ...:||:...||:|..:||:|                  .|.:
Human  2677 CSVDVDEPKHTGSGEDESGVP-VLVTSESRKVSSSSESEPELAQLKKGADSGLLPEPVIRVQPPS 2740

  Fly   221 P--------AAVGDVAENPISVKEATRKFNRMASEEEAK----------------IISPPAKKKP 261
            |        ::..:|...|:..|:.|.|.|....||..|                .:|..|:.:.
Human  2741 PLPSSMDSNSSPEEVQFQPVVSKQYTFKMNEDTQEEPGKSEEEKDSESHLAEDRHAVSTEAEDRS 2805

  Fly   262 EKQLIEEKDSPEVTLAH------PKAKEWIVS--MAKANYQELAKMASEYPELVKLQ-------- 310
            ..:|..:.|.|::...|      |.:....||  :......::.:....|.|.:.||        
Human  2806 YDKLNRDTDQPKICDGHGCEAMSPSSSAAPVSSGLQSPTGDDVDEQPVIYKESLALQGTHEKDTE 2870

  Fly   311 ---------------CPATGYTAL----HWAAKHGNE--DVVKLIAGTYKADVNARTNGGYTPL- 353
                           ||:..:::.    |.....|.|  :.:...:...|.:| .:|:..:..| 
Human  2871 GEELDVSRAESPQADCPSESFSSSSSLPHCLVSEGKELDEDISATSSIQKTEV-TKTDETFENLP 2934

  Fly   354 --------HLATQFGRDNIFELLWNVYKANRDIMDWSGNKPLDYSRQRSS-----VSASTCSSEY 405
                    .:.||..|          :..:..:.|.:.|..: |..|.:|     .|.|..|||.
Human  2935 KDCPSQDSSITTQTDR----------FSMDVPVSDLAENDEI-YDPQITSPYENVPSQSFFSSEE 2988

  Fly   406 AKYFFGADVGNSFRT--------LGFIESSQITGGTLGSALTRG--------KKRAQ-------- 446
            :|....|:...||.:        ...:|...:...:.|:.|::.        |..:|        
Human  2989 SKTQTDANHTTSFHSSEVYSVTITSPVEDVVVASSSSGTVLSKESNFEGQDIKMESQQESTLWEM 3053

  Fly   447 ------NRFATISGGSLGGVGGAVSR---------SQSMTVSRRPK-------KQPGQPISGIFK 489
                  :.|......:...||..:|:         |.|.:..|...       |:..|.|.|:..
Human  3054 QSDSVSSSFEPTMSATTTVVGEQISKVIITKTDVDSDSWSEIREDDEAFEARVKEEEQKIFGLMV 3118

  Fly   490 PATEDG---DLLPCEM---EGQPVPFRGASTRRKESFL---RKTFRATAGGSRRPLAKDVFTNPP 545
            .....|   |..|...   ||.|       |..:..||   .|.|..|..|:             
Human  3119 DRQSQGTTPDTTPARTPTEEGTP-------TSEQNPFLFQEGKLFEMTRSGA------------- 3163

  Fly   546 EHEIKARKKHAIEKDLGFLRIGSLNVRVKKTTEAFSNFLGVGNGSGVAPTGYGNGGSAVAANR-- 608
               |...|:...::...|.:||.     :...|..|..:..| .:|..|........::|.:.  
Human  3164 ---IDMTKRSYADESFHFFQIGQ-----ESREETLSEDVKEG-ATGADPLPLETSAESLALSESK 3219

  Fly   609 ---------------HHPRSHRAPHQRHHHHVGTTRSRHPNQRAAMST-----PYATNGGLP--- 650
                           .......|...:.:..:|.:.|.....:.|:|.     |....|.:|   
Human  3220 ETVDDEADLLPDDVSEEVEEIPASDAQLNSQMGISASTETPTKEAVSVGTKDLPTVQTGDIPPLS 3284

  Fly   651 --SRASVPNS---------------RNIYDGVHKSWGSADNIPHRSEDLMPPPKA----VEYISK 694
              .:.|.|:|               |::|.  .:...|.|:.|...:.::..|.|    |.:...
Human  3285 GVKQISCPDSSEPAVQVQLDFSTLTRSVYS--DRGDDSPDSSPEEQKSVIEIPTAPMENVPFTES 3347

  Fly   695 RNKSSKR-----------SSYASNTTDSPRDSICSSNSS---------------SNLNGGYSSMP 733
            ::|...|           :.|.|:.::....|:...|.:               ..:....|.:.
Human  3348 KSKIPVRTMPTSTPAPPSAEYESSVSEDFLSSVDEENKADEAKPKSKLPVKVPLQRVEQQLSDLD 3412

  Fly   734 TTPNQLRAPKG-IAASFAVDSDSDS---ACGFDS 763
            |:..:..||:| ..||.|.|:.|.|   |...||
Human  3413 TSVQKTVAPQGQDMASIAPDNRSKSESDASSLDS 3446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sowahNP_001137943.2 Ank_4 289..333 CDD:290365 9/72 (13%)
ANK <315..393 CDD:238125 13/92 (14%)
Ank_4 315..368 CDD:290365 10/67 (15%)
ANK repeat 315..346 CDD:293786 5/36 (14%)
ANK repeat 348..380 CDD:293786 4/40 (10%)
ANK2NP_001373103.1 Ank_2 35..>311 CDD:423045
ANK repeat 80..111 CDD:293786
ANK repeat 113..144 CDD:293786
ANK repeat 146..171 CDD:293786
Ank_2 202..>444 CDD:423045
ANK repeat 212..247 CDD:293786
ANK repeat 249..280 CDD:293786
ANK repeat 282..313 CDD:293786
ANK repeat 315..345 CDD:293786
ANK repeat 348..379 CDD:293786
ANK repeat 381..411 CDD:293786
ANK repeat 414..445 CDD:293786
PHA03095 421..>706 CDD:222980
ANK repeat 447..478 CDD:293786
ANK repeat 480..511 CDD:293786
ANK repeat 513..542 CDD:293786
ANK repeat 546..571 CDD:293786
Ank_2 578..>802 CDD:423045
ANK repeat 579..604 CDD:293786
ANK repeat 612..643 CDD:293786
ANK repeat 645..676 CDD:293786
ANK repeat 678..707 CDD:293786
ANK repeat 711..742 CDD:293786
ANK repeat 744..775 CDD:293786
ANK repeat 777..806 CDD:293786
Ank_4 778..830 CDD:372654
ZU5 1013..1150 CDD:128514
UPA_2 1371..1500 CDD:375346
PspC_subgroup_1 1549..>1922 CDD:411407
PTZ00449 <1717..2161 CDD:185628
Streccoc_I_II <1843..>2027 CDD:411384
Spc7_N <2493..>2634 CDD:373822 19/83 (23%)
rad2 <3031..>3565 CDD:273166 76/447 (17%)
PRK14949 <3196..>3442 CDD:237863 40/248 (16%)
Death_ank2 3614..3697 CDD:260066
NESP55 <3770..>3884 CDD:115071
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2336
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.