DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sowah and SPBP16F5.05c

DIOPT Version :9

Sequence 1:NP_001137943.2 Gene:sowah / 39438 FlyBaseID:FBgn0036302 Length:780 Species:Drosophila melanogaster
Sequence 2:NP_595779.1 Gene:SPBP16F5.05c / 2541266 PomBaseID:SPBP16F5.05c Length:146 Species:Schizosaccharomyces pombe


Alignment Length:137 Identity:30/137 - (21%)
Similarity:56/137 - (40%) Gaps:32/137 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   305 ELVKLQCP-------ATGYTALHWAAKHGNEDVV-KLIAGTYKADVNARTNGGYTPLHLATQFGR 361
            |::: :||       ..|.:.||.|:.:|:..|| |:|....|..:||:...|.|.:|.|...|.
pombe    20 EIIE-KCPQELSRRDENGNSGLHMASANGHIAVVQKIIPYLNKEVINAQNESGNTAMHWAALNGH 83

  Fly   362 DNIFELLWNVYKANRDIMDWSGNKPLDYSRQRSSVSASTCSSEYAKYFFGADVGNSFRTLGFIES 426
            ..|.:||          ::..|:..:....::|.:             :.||:.|..:.:.....
pombe    84 AEICKLL----------LEAGGDPHIKNIYEKSPI-------------YEADIRNQQKVMDLFLD 125

  Fly   427 SQITGGT 433
            .:|..|:
pombe   126 FEIAKGS 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sowahNP_001137943.2 Ank_4 289..333 CDD:290365 10/35 (29%)
ANK <315..393 CDD:238125 21/78 (27%)
Ank_4 315..368 CDD:290365 18/53 (34%)
ANK repeat 315..346 CDD:293786 12/31 (39%)
ANK repeat 348..380 CDD:293786 8/31 (26%)
SPBP16F5.05cNP_595779.1 ANK 6..124 CDD:238125 28/127 (22%)
Ank_2 6..101 CDD:289560 24/91 (26%)
ANK repeat 6..33 CDD:293786 3/13 (23%)
ANK repeat 35..68 CDD:293786 12/32 (38%)
ANK repeat 70..101 CDD:293786 9/40 (23%)
Ank_2 76..>136 CDD:289560 13/80 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2336
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.